SecReT4
Protein ID: 160431638
T4SS name [ID]Trw [155]
Gene symboltraF
Locus tagMAK2.32
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK2 (NC_009980)
Repliconplasmid pMAK2 [GenBank: NC_009980] [Browse all T4SS(s) in this replicon]
Location [Strand]33782..34942 [+]
ProductTraF protein
Component typeTrwE
UniProt IDA8R723
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1e-53, Aligned region: 202..377
Protein Sequence: 386 a.a.     [Download]
>gi|160431638|ref|YP_001551805.1| TraF protein [Salmonella enterica subsp. enterica serovar Dublin]
MARKSVDVDQELDENTGDGEFESERGGFNGSNRRSAPGMKAFVILMALLALVFIGITVMGKIRAPAKAEA
DKDGGKAQQANTLPNYSFNSDPDVNKPATAQNSATDARAVQAAAQADADAGSSNTGARTSNKRKEPSPEE
LAMQRRLGGELAQTNQAATSNSPGAQPQDNETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMIP
CGTGTELDTTVPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVLWERIRNDQDGTIV
NIDSAGTNSLGSAGIPGQVDAHMWERLRGAIMISLFSDTLTALVNQTQSNNIQYNSTENSGGQLASEALR
SYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|160431608|ref|NC_009980.1|:33782-34942 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK2, complete sequence
ATGGCCCGTAAAAGTGTCGATGTAGATCAGGAACTCGATGAAAACACCGGAGACGGTGAATTTGAAAGCG
AGCGTGGCGGATTTAATGGCAGTAACCGCCGTTCGGCTCCTGGTATGAAAGCCTTTGTCATACTGATGGC
GCTGCTTGCTTTGGTATTCATCGGGATTACGGTCATGGGTAAAATTCGCGCCCCGGCTAAAGCTGAAGCT
GATAAAGACGGTGGTAAAGCGCAACAGGCCAATACACTGCCAAACTACAGCTTTAACAGCGATCCTGATG
TTAATAAACCTGCAACTGCGCAGAATAGCGCCACTGATGCCCGTGCTGTGCAGGCTGCCGCACAGGCAGA
TGCAGATGCGGGCAGCAGCAATACCGGCGCGCGTACCTCTAATAAGCGTAAAGAACCTTCGCCTGAAGAA
CTGGCTATGCAGCGTCGTCTGGGCGGCGAGCTGGCCCAGACTAATCAGGCGGCTACAAGCAATAGTCCCG
GAGCGCAGCCCCAGGACAACGAAACAAGCGAAGGTAGTTCAGCACTCGCTAAAAACCTGACTCCTGCAAG
GCTGAAGGCTAGCCGCGCTGGAGTCATGGCTAATCCCAGCCTGACTGTTCCGAAAGGCAAAATGATCCCC
TGTGGTACCGGCACCGAGCTGGATACCACTGTTCCGGGTCAGGTTTCCTGCCGGGTTTCACAGGACGTTT
ACTCAGCTGATGGACTCGTTAGGCTGATTGATAAAGGCTCATGGGTTGACGGGCAGATTACCGGTGGTAT
CAAAGACGGCCAGGCGCGCGTGTTTGTTCTCTGGGAGCGTATCCGTAATGACCAGGACGGGACAATCGTT
AATATTGACAGTGCCGGAACGAACTCACTCGGCAGCGCGGGGATTCCGGGCCAGGTGGATGCCCATATGT
GGGAGCGTCTGCGTGGTGCGATCATGATTTCGTTGTTCTCTGACACCTTAACGGCGCTGGTTAACCAGAC
GCAGAGTAATAACATTCAGTACAACAGCACAGAAAACAGCGGTGGGCAGCTGGCGTCTGAAGCACTCCGC
TCTTACATGTCTATCCCCCCTACCCTCTACGATCAGCAGGGTGATGCGGTGAGCATTTTTGTTGCCCGCG
ACCTCGATTTCAGCGGCGTTTATACGCTCGCAGACAACTAA
 Primer design