SecReT4
Protein ID: 160431665
T4SS name [ID]Trw [142]
Gene symboltrwL
Locus tagMAK3.05
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK3 (NC_009982)
Repliconplasmid pMAK3 [GenBank: NC_009982] [Browse all T4SS(s) in this replicon]
Location [Strand]2069..2407 [+]
ProducttrwL protein
Component typeTrwL
UniProt IDA8R749
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-18, Aligned region: 17..110
Protein Sequence: 112 a.a.     [Download]
>gi|160431665|ref|YP_001552053.1| trwL protein [Salmonella enterica subsp. enterica serovar Dublin]
MATSILTRKTNMKNLNYLRAKANGKLAAIFGAIAAMLTAQPAAAQGLEKARSVLETLQQELTTIVPIAAA
VILLCLGIAYAGRFIEKDTFVRWSIGVIIAGSAVQITAMLFT
 
Nucleotide Sequence: 339 bp     [Download]
>gi|160431661|ref|NC_009982.1|:2069-2407 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK3, complete sequence
ATGGCAACTTCAATCTTGACGAGGAAAACAAACATGAAGAACCTGAACTACCTCCGGGCGAAAGCTAACG
GAAAGCTGGCCGCGATTTTTGGAGCAATAGCGGCCATGCTCACCGCTCAACCGGCGGCGGCTCAAGGATT
GGAAAAGGCGAGGAGCGTCCTCGAAACATTGCAGCAGGAACTTACGACGATTGTGCCCATTGCGGCCGCT
GTCATCCTGCTCTGCCTCGGCATCGCATACGCGGGCCGATTCATCGAAAAGGATACGTTTGTGCGGTGGT
CTATCGGCGTCATCATTGCCGGTTCCGCCGTCCAGATTACGGCCATGCTGTTTACCTAA
 Primer design