SecReT4
Protein ID: 160431668
T4SS name [ID]Trw [142]
Gene symboltrwJ
Locus tagMAK3.08
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK3 (NC_009982)
Repliconplasmid pMAK3 [GenBank: NC_009982] [Browse all T4SS(s) in this replicon]
Location [Strand]5205..5894 [+]
ProducttrwJ protein
Component typeTrwJ
UniProt IDA8R752
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 9.3e-59, Aligned region: 24..212
OmpH [PF03938], Evalue: 3.2e-05, Aligned region: 9..207
Protein Sequence: 229 a.a.     [Download]
>gi|160431668|ref|YP_001552056.1| trwJ protein [Salmonella enterica subsp. enterica serovar Dublin]
MKKLVMTAAVAAILGAASPVMAQGIPVFDGTRALDFVQQFARMKEQLDTAKDQLAEAQRMYEAVTGGRGL
GDLMRNAQLREYLPDDLRTVYDSANGGGYSGISGSINDILRDERLNGSVADMRRSIEERSRTAAATDKAV
GLRAYEGAQQRLAQIEGLMDEISRTQDQKAIEELQARIAGEQAAIQNETTKLQMIAQLRQAEQALISEQR
RERNMRILSSGNQGMPTIQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|160431661|ref|NC_009982.1|:5205-5894 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK3, complete sequence
ATGAAGAAGCTGGTTATGACGGCGGCGGTGGCCGCCATTCTTGGGGCGGCAAGCCCTGTAATGGCCCAGG
GTATTCCTGTTTTCGACGGCACGCGGGCACTAGATTTTGTCCAACAGTTTGCCCGCATGAAAGAACAGCT
CGACACGGCCAAAGATCAGCTCGCCGAAGCGCAGCGCATGTATGAGGCCGTCACGGGTGGCCGTGGTCTT
GGGGATTTGATGCGCAATGCGCAACTCCGCGAATATCTGCCGGATGATTTGCGCACTGTCTATGACTCGG
CCAATGGTGGCGGGTATTCGGGCATTTCTGGCTCGATCAATGACATTCTGCGGGATGAGCGCCTTAACGG
CTCCGTGGCCGATATGCGCCGCTCTATCGAGGAACGTAGCCGCACGGCGGCGGCAACCGACAAGGCCGTT
GGCCTGCGGGCCTACGAAGGGGCACAGCAACGCCTCGCGCAGATTGAAGGGCTGATGGATGAAATTAGCC
GTACCCAAGACCAAAAGGCCATTGAAGAATTGCAAGCCCGTATCGCGGGCGAGCAAGCCGCTATCCAGAA
CGAAACGACGAAGCTGCAAATGATCGCGCAACTGCGGCAAGCAGAACAGGCGTTGATTTCGGAGCAACGA
CGCGAGCGCAACATGCGCATCCTGAGTAGTGGAAACCAAGGAATGCCGACTATCCAATGA
 Primer design