SecReT4
Protein ID: 160431671
T4SS name [ID]Trw [142]
Gene symboltrwH
Locus tagMAK3.11
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK3 (NC_009982)
Repliconplasmid pMAK3 [GenBank: NC_009982] [Browse all T4SS(s) in this replicon]
Location [Strand]7276..7419 [+]
ProducttrwH protein
Component typeTrwH
UniProt IDA7KZV0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 47 a.a.     [Download]
>gi|160431671|ref|YP_001552059.1| trwH protein [Salmonella enterica subsp. enterica serovar Dublin]
MKTIIFAILMTGLLSACASAPKPKQPSDFNREPVNKTVPVEIQRGAL
 
Nucleotide Sequence: 144 bp     [Download]
>gi|160431661|ref|NC_009982.1|:7276-7419 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK3, complete sequence
GTGAAAACCATCATTTTTGCAATTTTGATGACGGGGCTATTGTCGGCGTGTGCATCGGCTCCCAAGCCGA
AGCAGCCGAGTGATTTCAACCGGGAGCCGGTCAACAAGACGGTGCCCGTGGAAATTCAGCGAGGGGCACT
ATGA
 Primer design