SecReT4
Protein ID: 160431672
T4SS name [ID]Trw [142]
Gene symboltrwG
Locus tagMAK3.12
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK3 (NC_009982)
Repliconplasmid pMAK3 [GenBank: NC_009982] [Browse all T4SS(s) in this replicon]
Location [Strand]7416..8111 [+]
ProducttrwG protein
Component typeTrwG
UniProt IDA8R756
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.3e-58, Aligned region: 21..227
Protein Sequence: 231 a.a.     [Download]
>gi|160431672|ref|YP_001552060.1| trwG protein [Salmonella enterica subsp. enterica serovar Dublin]
MSKKQPKPVKAEQLKSYYEESRGLERDLIGEFVKSRKTAWRVATASGLFGLLGMVCGIVGFSQPAPAPLV
LRVDNATGAVDVVTTLREHESSYGEVVDTYWLNQYVLNREAYDYNTIQMNYDTTALLSAPAVQQDYYKLF
DGSNARDRVLGNKARITVRVRSIQPNGRGQATVRFTTQQHNSNGTVEAPQHQIATIGYTYIGAPMRSSDR
LLNPLGFQVTSYRADPEILNN
 
Nucleotide Sequence: 696 bp     [Download]
>gi|160431661|ref|NC_009982.1|:7416-8111 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK3, complete sequence
ATGAGCAAGAAGCAACCAAAACCGGTCAAGGCAGAACAGCTCAAAAGCTACTATGAGGAAAGCCGTGGCT
TGGAACGGGATTTGATTGGCGAGTTCGTCAAATCGCGCAAGACCGCTTGGCGGGTGGCAACGGCGAGCGG
CCTTTTCGGCCTGCTTGGCATGGTGTGTGGAATTGTCGGGTTCTCCCAACCGGCTCCCGCGCCCTTGGTG
CTTCGGGTGGATAACGCCACGGGTGCCGTCGATGTGGTGACGACGCTGCGCGAGCATGAGTCCAGCTATG
GCGAAGTGGTCGATACGTACTGGCTCAATCAGTACGTGCTCAATCGCGAAGCCTACGACTACAACACAAT
CCAAATGAACTATGACACGACGGCGCTATTGAGCGCCCCGGCGGTTCAGCAGGATTACTACAAGCTCTTT
GACGGCTCGAATGCGCGTGATCGGGTCTTGGGGAACAAAGCCCGCATTACCGTTCGGGTGCGCTCCATCC
AACCTAATGGCCGCGGCCAAGCGACGGTGCGCTTTACGACGCAACAGCACAACAGCAATGGCACGGTCGA
AGCTCCGCAACATCAGATAGCGACGATTGGCTATACCTACATCGGTGCGCCGATGCGTTCATCTGATCGG
TTGCTTAACCCTCTTGGTTTCCAGGTCACAAGCTATCGCGCTGACCCGGAAATACTCAATAACTGA
 Primer design