SecReT4
Protein ID: 160431673
T4SS name [ID]Trw [142]
Gene symboltrwF
Locus tagMAK3.13
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK3 (NC_009982)
Repliconplasmid pMAK3 [GenBank: NC_009982] [Browse all T4SS(s) in this replicon]
Location [Strand]8122..8922 [+]
ProducttrwF protein
Component typeTrwF
UniProt IDA8R757
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.8e-64, Aligned region: 30..240
Protein Sequence: 266 a.a.     [Download]
>gi|160431673|ref|YP_001552061.1| trwF protein [Salmonella enterica subsp. enterica serovar Dublin]
MKKLAIVALLASLHAVPALALDVPSSSRYDHRIRYVTYNPADVVQVDTVLGVATHIMLEEGEQYLTHAFG
DSEAYAFARKGRHIFIKPQAELANTNLIVVTDRRSYKFRLQMRNDRNGAMYELAFRYPDTQARQTREANA
RAAVEAAFEQRVGAYYNLKYMMSGDKDIAPVNAWDDGRFTYFKFSANADLPSIYFVDAEGNESLVPRTTV
GSSNNIIAVHKVNPKWMIRLGNRALAIFNEAYDPNGVPNDTGTASPAVRRVNKGGN
 
Nucleotide Sequence: 801 bp     [Download]
>gi|160431661|ref|NC_009982.1|:8122-8922 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK3, complete sequence
ATGAAGAAACTAGCTATCGTTGCATTGCTGGCCTCGCTTCATGCGGTGCCCGCTTTGGCCCTCGATGTGC
CGTCCAGCTCGCGTTACGACCATCGGATTCGATACGTGACGTACAACCCGGCTGATGTGGTGCAGGTCGA
TACCGTTCTTGGTGTCGCAACACACATCATGCTTGAGGAAGGTGAGCAATATCTGACGCATGCCTTTGGC
GATTCCGAAGCCTATGCCTTTGCCCGGAAGGGGCGGCATATTTTTATCAAGCCGCAGGCCGAGCTAGCCA
ATACCAACCTCATCGTCGTGACTGACCGACGCAGCTACAAATTCCGTTTGCAAATGCGGAATGACCGCAA
TGGGGCCATGTATGAGCTGGCTTTCCGTTATCCCGATACGCAGGCCCGGCAAACTCGGGAAGCGAACGCA
CGGGCCGCTGTCGAGGCTGCATTCGAGCAACGTGTAGGGGCCTATTACAACCTCAAATACATGATGAGCG
GCGACAAGGACATTGCGCCGGTCAACGCTTGGGATGATGGGCGTTTCACCTACTTCAAGTTCTCTGCCAA
TGCCGATTTGCCGTCGATCTACTTTGTGGATGCGGAAGGCAATGAAAGCCTTGTGCCGCGCACTACGGTT
GGCTCGTCCAACAACATCATTGCCGTTCACAAGGTCAATCCCAAGTGGATGATTCGACTTGGTAACCGCG
CCTTGGCGATCTTCAATGAAGCGTATGACCCCAATGGTGTGCCGAATGACACTGGCACAGCCTCCCCGGC
GGTTCGTCGCGTCAACAAAGGAGGCAACTAA
 Primer design