SecReT4
Protein ID: 160431674
T4SS name [ID]Trw [142]
Gene symboltrwE
Locus tagMAK3.14
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pMAK3 (NC_009982)
Repliconplasmid pMAK3 [GenBank: NC_009982] [Browse all T4SS(s) in this replicon]
Location [Strand]8922..10109 [+]
ProducttrwE protein
Component typeTrwE
UniProt IDA8R758
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.3e-63, Aligned region: 205..383
Protein Sequence: 395 a.a.     [Download]
>gi|160431674|ref|YP_001552062.1| trwE protein [Salmonella enterica subsp. enterica serovar Dublin]
MFGRKKGDVIDAGAELERAEQERIEGEYGASELASERRPHTPGARTLLMVLLCVIAVVLVTLSYKAYKVR
GVVEDDDAQPQQVVRQVIPGYTPRPIRPEPENVPEPPQPTTSVPAIQPAPVTQPVRPQPTGPREKTPYEL
ARERMLRSGLTAGSGGGEDLPRPQGGDVPAGGLMGGGGGGGELAEKLQPMRLSGSSAGRLGNRDMLITQG
TQLDCVLETRLVTTQPGMTTCHLTRDVYSTSGRVVLLDRGSKVVGFYQGGLRQGQARIFVQWSRIETPSG
VVINLDSPGTGPLGEAGLGGWIDRHFWERFGGAIMISLIGDLGDWASRQGSRQGDNSIQFSNTANGVESA
AAEALRNSINIPPTLYKNQGERVNILVARDLDFSDVYSLESIPTK
 
Nucleotide Sequence: 1188 bp     [Download]
>gi|160431661|ref|NC_009982.1|:8922-10109 Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK3, complete sequence
ATGTTCGGTCGCAAGAAAGGAGACGTAATCGACGCGGGCGCGGAACTGGAACGCGCCGAGCAGGAACGTA
TCGAGGGCGAATATGGCGCTTCCGAGCTGGCTTCGGAACGTCGCCCGCATACTCCCGGTGCTCGCACGCT
GCTTATGGTGCTGCTGTGCGTGATTGCCGTGGTGCTGGTGACGCTCTCATACAAGGCGTACAAAGTGCGC
GGGGTTGTCGAGGATGACGACGCGCAGCCGCAACAGGTCGTGCGCCAAGTCATTCCGGGTTATACGCCGC
GTCCAATCCGACCCGAGCCGGAAAACGTACCTGAACCGCCGCAACCGACTACATCGGTTCCAGCGATTCA
GCCCGCGCCGGTAACGCAGCCAGTGCGCCCGCAACCGACCGGCCCGCGTGAAAAAACGCCCTATGAGCTG
GCCCGCGAACGCATGTTGCGCTCTGGCCTGACGGCGGGCAGCGGTGGCGGTGAGGATCTTCCTCGGCCGC
AAGGCGGCGATGTGCCTGCCGGTGGTCTGATGGGTGGCGGTGGTGGCGGCGGTGAGCTGGCCGAAAAGCT
GCAACCGATGCGCCTTTCGGGTTCAAGTGCTGGCCGCCTTGGCAACCGTGACATGCTGATAACGCAGGGA
ACGCAGCTCGATTGCGTGCTTGAAACGCGCCTTGTGACGACGCAACCCGGCATGACTACCTGCCATCTGA
CGCGGGACGTTTACTCGACCAGTGGCCGCGTAGTGCTGCTTGATCGTGGCTCTAAAGTCGTCGGGTTCTA
TCAAGGCGGGCTGCGGCAAGGCCAAGCGCGAATCTTTGTGCAGTGGTCGCGGATTGAAACGCCCTCCGGT
GTCGTCATCAACCTAGATTCTCCCGGTACTGGCCCGCTTGGCGAAGCTGGTTTGGGTGGCTGGATTGATC
GGCATTTTTGGGAGCGTTTCGGCGGTGCCATCATGATTAGCTTGATCGGTGATTTGGGCGATTGGGCAAG
CCGTCAAGGCAGTCGCCAAGGCGATAACTCTATCCAGTTTTCCAACACTGCGAACGGGGTGGAATCGGCT
GCTGCGGAAGCTCTGCGCAACTCGATCAACATTCCGCCCACTCTGTATAAAAACCAAGGCGAGCGGGTGA
ATATCCTCGTCGCCCGTGATCTGGATTTCAGCGATGTCTACAGTCTCGAAAGCATCCCCACTAAGTAG
 Primer design