SecReT4
Protein ID: 160431727
T4SS name [ID]Tra_F [574]
Gene symboltrhW
Locus tagMAK1.14
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]14492..16000 [+]
Productplasmid transfer protein
Component typeTraW_F
UniProt IDA8R6B6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 2.2e-24, Aligned region: 195..276
Protein Sequence: 502 a.a.     [Download]
>gi|160431727|ref|YP_001551841.1| plasmid transfer protein [Salmonella enterica subsp. enterica serovar Choleraesuis]
MRSFELKTTIKPLASCLAFYALISTAVASPQYQQVADDIARQAQVLGAQIPVPHASEGPLPSGSLDSPDT
KKYIRQAEAMKKNGDLSQQTNRGYVPGMNADSVQAVIDHTQAIRAQSNNSEAVNDIIRRRDEIQGNSQLS
ESALKSVENKPEVMRSQSSNIEKMFGSSGITAADFERKIDSSREEVLSTENGITIFASFSLPDYVLEDLL
RTASEHKARVVFNGLKKGTTRLPETQAAINQLVVKGKFDSPLITIDPDAFNQYQITQVPTIISREQSRFA
KMVGSFNVDFFQRELARKPDQDLFPIAGTTYPVEEKSIIKELEERAQKYDWDGAKKRAVADTWKNQYMVN
LPPAQEHKEWLIDPTIRVTQDVKDKQGRVIASAGELINPLARFPQNLTMIIFDPMNPGQLEWAEKQYRQR
LGSGQVMPMFTRIKQENGWDHLNDLREKFNGKVFKVNEQIIARFQIKNTPALISTEKEKFRITQFSEAEI
RGIGTKIAAEEN
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|160431713|ref|NC_009981.1|:14492-16000 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGCGATCTTTTGAATTAAAAACAACTATTAAGCCTCTGGCCTCCTGTCTGGCATTTTACGCCTTAATAT
CCACCGCTGTGGCTAGCCCCCAGTATCAACAGGTTGCTGATGACATTGCAAGGCAAGCTCAGGTTCTGGG
CGCCCAAATACCGGTACCACACGCATCAGAAGGTCCGCTCCCGTCTGGTTCTCTGGATTCTCCTGATACC
AAGAAATACATCCGCCAGGCCGAAGCTATGAAGAAAAACGGGGACCTCAGTCAGCAAACAAATCGCGGTT
ATGTCCCGGGTATGAATGCTGACAGTGTGCAGGCAGTTATAGACCATACGCAGGCTATCCGCGCTCAGAG
TAATAACTCGGAAGCAGTTAACGACATCATTCGCAGACGTGATGAGATTCAGGGAAATTCACAGCTCAGC
GAGTCTGCACTGAAATCCGTCGAAAATAAACCAGAAGTTATGCGCAGTCAGTCTTCGAATATCGAAAAGA
TGTTTGGTTCATCAGGAATCACCGCCGCTGACTTCGAGCGTAAAATAGACAGCAGTCGGGAAGAGGTGCT
CTCGACAGAAAACGGTATCACTATCTTTGCGTCATTTAGCTTGCCTGATTACGTCCTGGAAGATCTACTC
CGTACCGCGTCAGAACATAAGGCGAGAGTGGTTTTTAATGGTCTGAAGAAAGGCACTACACGCCTCCCTG
AAACTCAGGCAGCTATCAACCAGCTGGTGGTGAAGGGGAAGTTTGACTCCCCACTAATTACGATTGACCC
GGACGCATTTAACCAGTACCAGATCACGCAGGTCCCGACAATAATCTCCCGTGAGCAATCCCGGTTTGCA
AAAATGGTCGGCTCTTTCAACGTTGATTTCTTCCAGCGCGAACTGGCCAGAAAACCCGACCAAGATCTTT
TCCCGATTGCTGGTACGACCTATCCGGTTGAAGAGAAGAGCATTATTAAAGAGCTCGAAGAGCGAGCACA
GAAATACGACTGGGACGGCGCCAAGAAGAGAGCAGTCGCTGATACCTGGAAAAACCAGTACATGGTTAAT
CTGCCTCCCGCTCAAGAGCACAAGGAATGGCTAATCGACCCGACAATCAGGGTTACTCAGGACGTTAAAG
ATAAGCAGGGTCGCGTCATTGCTTCTGCTGGCGAGCTCATTAACCCACTGGCCAGGTTCCCGCAGAACCT
CACAATGATAATTTTTGACCCAATGAACCCAGGGCAACTTGAGTGGGCAGAGAAGCAATATCGCCAGCGT
CTTGGCAGCGGTCAGGTGATGCCGATGTTCACGCGCATCAAACAGGAAAATGGATGGGATCATTTGAATG
ATCTGCGCGAAAAATTCAATGGGAAGGTGTTCAAAGTTAATGAGCAAATTATTGCTCGTTTCCAGATAAA
AAACACGCCAGCGCTGATCTCCACTGAAAAAGAGAAATTCCGTATAACGCAATTCAGTGAAGCTGAAATA
CGTGGTATTGGAACAAAAATCGCGGCAGAGGAGAATTGA
 Primer design