SecReT4
Protein ID: 160431728
T4SS name [ID]Tra_F [574]
Gene symboltrhU
Locus tagMAK1.15
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]16190..17197 [+]
Productplasmid transfer protein
Component typeTraU_F
UniProt IDA8R6B8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.4e-71, Aligned region: 32..331
Protein Sequence: 335 a.a.     [Download]
>gi|160431728|ref|YP_001551842.1| plasmid transfer protein [Salmonella enterica subsp. enterica serovar Choleraesuis]
MLSLSLPAMTMAADTGVPGAMCQSAGVWQGLIKNICWSCIFPMRIMGIGAAPEGAAPSRPGCYCTDQNGI
PEIGWQLSFFQPVKIVEVVKSPWCSPFLEGTMLQKSQFDIGKSNTNQPMTATEAGFYDVHLWEFPIMTML
KLLVIGECTAEPYVDASLTYISEVDPMWESDLLTLVLNPEAVVFANPIASMVCAADCVAVTAGKDNLAAY
FCAGCDGNLYPLTGHIYANDDAVRTSSLITQRLLTKLHRQGMLMRTMGADAMCEKTWEYFTPRSQYRLSM
LYPTPEANGPDCCHRLGDSVHDWSTLKGGRKKIGIDNYVYMLWRYNDCCVRYIPN
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|160431713|ref|NC_009981.1|:16190-17197 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGCTGTCGCTCTCGCTGCCTGCAATGACAATGGCCGCAGATACCGGTGTCCCGGGAGCAATGTGCCAGT
CAGCGGGAGTATGGCAGGGCCTAATCAAAAACATCTGCTGGAGTTGTATCTTCCCGATGCGGATCATGGG
AATTGGAGCAGCCCCTGAAGGTGCCGCCCCCTCACGCCCTGGTTGCTATTGCACGGATCAAAATGGGATA
CCAGAAATCGGATGGCAGCTAAGTTTTTTCCAACCAGTAAAAATTGTTGAAGTGGTGAAAAGTCCGTGGT
GCAGCCCATTTTTAGAGGGAACCATGCTGCAAAAATCACAGTTCGACATCGGCAAGAGCAATACTAACCA
GCCTATGACCGCAACAGAAGCCGGATTCTACGACGTACATCTCTGGGAATTCCCAATCATGACGATGTTG
AAATTGCTGGTTATTGGTGAATGTACAGCAGAACCTTATGTTGATGCCAGTCTGACGTATATCAGCGAAG
TAGATCCGATGTGGGAAAGTGACCTATTGACGCTCGTGCTAAACCCCGAAGCTGTGGTATTTGCAAACCC
TATCGCCTCAATGGTATGTGCAGCTGACTGCGTGGCCGTGACTGCCGGGAAGGATAATTTGGCTGCATAT
TTTTGTGCCGGGTGTGATGGGAACCTTTATCCGTTAACTGGACACATCTATGCGAATGATGATGCCGTCA
GAACCAGCTCACTTATAACTCAGCGTCTACTGACGAAGTTACATAGGCAGGGAATGCTTATGAGAACAAT
GGGAGCTGACGCAATGTGTGAAAAAACGTGGGAATACTTCACTCCTCGATCTCAATACCGACTTTCAATG
CTTTACCCAACGCCGGAGGCGAATGGTCCGGATTGCTGTCATCGCCTAGGCGATTCTGTCCATGACTGGT
CAACGCTTAAAGGTGGACGGAAAAAAATCGGCATAGATAACTATGTTTACATGCTGTGGCGCTATAATGA
TTGCTGCGTCAGGTATATACCCAACTAA
 Primer design