SecReT4
Protein ID: 160431729
T4SS name [ID]Tra_F [574]
Gene symboltrhN
Locus tagMAK1.16
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]17220..20396 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA8R6B9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 5.6e-24, Aligned region: 541..710
TraN [PF06986], Evalue: 5.6e-24, Aligned region: 868..935
Protein Sequence: 1058 a.a.     [Download]
>gi|160431729|ref|YP_001551843.1| conjugal transfer mating pair stabilization protein TraN [Salmonella enterica subsp. enterica serovar Choleraesuis]
MKHRKIISSAIIASMIANTMSWAFYVSLINIALTPKIFAADAIFDQLENNFNLANPNANRNATTSAQDIV
EKYKNADSGENLSGKISEKYVGKAESTNLNVGKYGTPNSNESVMSNAVSDGKSIGKAVQLPSMSGGTINS
NYTKEGAKLLSRDSSGNIGISNNPNTTAGTKTSTGELFSSEQKHSDVQFNAGGRYGDENGFINDIKNRKS
QLFEAQSYDGVAYRTLVNANKENPASTIKPNDPMFNAGRNEIGNAVAGTGNWLQNCNTETSKQTITTHYP
DYKEFYCNSPKKDNFNSCTITRDFSVPVYISGGNGDMSMCGDNCVRVWFGRRDDNYWNDGVYDNSLTLKF
HPDAKLATAKIINAEWDDHMRVTLDGTQIFAHIDGAYRSSNYPSPQGQWELKKSWKLDKVYDITEQVKTS
VYQEQDREVTMASRVWVGGGGEGYFEVEMTFENMKLEDKHIQEPAGCFDAVQTPNSFCRFDRFVNMDVGT
KRLPESVLKMATPLYKGDTGYLTWKTNLEGYFCDPLAKEKLCSYDAKGNIMKDPTGKDLCYNYDDIKNMP
DACSTYKNDAACVLDNQTCAEGWFDEGTNTCYMYEQKYTCDRGKDVVREVESQTNSCVGMIPCSGGTCET
GPKEENKDFGKVAAYSNMVQYMQGEAKCEDPNDPNSCSVFEGKAEWCGRSVGFVNGLAKTDCCEKPQGAA
GSLEAIMLAGSMIRNTNWTRVNAQLVNWTGGESGTWASMANSVGEWTASAGKTVGQMWNNVTSSITSVYE
NVAGNLGRTVGSSAAGESGQLAKETMSSFGLGKLKQMAMEKAYDLLPDTVRDFVFKNVATTGGEIVFSAA
VQNFMLALNVIGWIYTAYQVTKMLLEMLVACDQKEMEASIHKNQKSCFTLDTNRCVKYLNLGFTKKCVKK
ATDMCCYNSMLSRVIMQQAYPQLGIDPVTSNCVGLSIGQIQKLDFDKIDLTEWINDAVQVGEVPDQYATF
SESSITANLPFKNENYQLPSERTKDAMGGEENMIKARQENAQAIKEENVDCSYLPRPAICEVGSTYVDPI
TGKEIPKY
 
Nucleotide Sequence: 3177 bp     [Download]
>gi|160431713|ref|NC_009981.1|:17220-20396 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGAAACATAGAAAAATAATTTCTTCAGCAATTATTGCGTCTATGATAGCTAATACTATGAGTTGGGCAT
TTTACGTTTCGCTCATAAACATTGCGTTAACGCCTAAAATATTTGCGGCAGATGCGATTTTTGACCAGCT
TGAAAACAATTTTAACCTTGCCAATCCCAACGCCAACCGGAACGCAACCACCAGTGCTCAGGATATTGTG
GAAAAGTATAAAAATGCTGATTCCGGGGAAAATCTGAGCGGCAAAATTTCCGAGAAATATGTTGGTAAAG
CAGAGTCAACAAACCTAAATGTTGGGAAGTACGGGACGCCGAACTCAAATGAAAGTGTTATGAGTAATGC
GGTGTCCGACGGGAAATCGATCGGTAAGGCTGTACAATTACCTAGCATGTCGGGCGGTACAATTAACTCG
AATTATACGAAAGAGGGGGCAAAGTTACTTTCTAGGGACAGCAGCGGTAATATTGGAATAAGTAACAACC
CGAATACAACGGCAGGTACCAAAACCAGTACAGGGGAACTATTCAGCTCAGAGCAGAAGCACAGTGATGT
TCAGTTCAATGCTGGTGGCCGGTATGGAGATGAAAATGGCTTCATCAATGACATCAAAAATCGAAAAAGT
CAGCTGTTTGAAGCGCAAAGTTATGATGGAGTCGCCTACCGTACTCTGGTGAATGCAAATAAAGAAAACC
CAGCATCTACTATTAAACCTAACGACCCTATGTTCAATGCGGGTCGTAACGAAATAGGAAATGCTGTAGC
TGGTACAGGAAACTGGCTACAGAATTGTAATACGGAAACATCAAAACAAACAATTACTACGCACTATCCA
GATTACAAAGAGTTTTACTGCAATTCACCCAAGAAAGATAATTTTAACAGTTGCACGATAACTCGTGATT
TTTCCGTGCCGGTTTATATCTCAGGTGGTAATGGTGATATGTCCATGTGCGGAGATAATTGTGTGAGAGT
CTGGTTTGGCAGAAGGGACGACAACTATTGGAACGATGGAGTCTATGACAACTCATTAACCTTAAAATTC
CATCCAGATGCAAAGCTCGCAACTGCGAAAATAATTAACGCAGAGTGGGATGACCATATGAGGGTCACGC
TTGATGGTACACAGATTTTTGCTCATATAGATGGAGCATATAGAAGTAGCAATTATCCATCTCCACAAGG
TCAATGGGAGTTAAAGAAATCCTGGAAGCTCGATAAAGTCTACGATATTACTGAACAAGTAAAAACCTCT
GTATATCAGGAGCAGGATCGTGAAGTGACTATGGCTTCGCGCGTATGGGTTGGCGGTGGTGGGGAAGGCT
ATTTTGAAGTTGAGATGACTTTTGAAAATATGAAGTTGGAGGATAAACATATACAGGAGCCCGCAGGATG
TTTTGATGCAGTACAAACGCCGAATTCATTCTGTCGGTTTGACAGGTTTGTCAACATGGATGTTGGTACA
AAGCGACTCCCGGAAAGTGTGCTTAAGATGGCCACACCGCTTTACAAAGGTGATACAGGATACTTAACCT
GGAAAACAAACCTTGAAGGCTATTTCTGTGATCCCCTGGCGAAGGAAAAACTGTGCTCTTATGATGCGAA
GGGAAACATCATGAAAGACCCCACAGGCAAAGACCTTTGCTACAACTACGACGATATAAAAAATATGCCT
GACGCATGCAGCACATATAAAAATGATGCTGCGTGTGTGCTAGATAATCAGACATGTGCTGAAGGTTGGT
TCGATGAAGGCACAAATACTTGCTACATGTATGAGCAGAAATATACATGTGACAGAGGGAAAGACGTAGT
CAGAGAGGTAGAGTCACAGACTAACTCCTGTGTAGGTATGATCCCATGTTCTGGCGGAACATGTGAAACA
GGCCCAAAAGAAGAAAACAAAGATTTTGGGAAAGTGGCCGCGTACTCCAATATGGTTCAGTACATGCAAG
GTGAAGCAAAATGCGAAGATCCAAACGACCCTAACTCCTGCTCTGTCTTTGAAGGGAAAGCAGAGTGGTG
CGGCAGGTCCGTTGGTTTTGTGAACGGACTGGCCAAAACAGATTGCTGCGAAAAGCCGCAGGGTGCTGCT
GGGTCACTGGAGGCGATAATGCTGGCCGGGTCGATGATCCGAAACACGAACTGGACCCGAGTGAATGCTC
AACTGGTAAACTGGACTGGAGGGGAGAGCGGAACCTGGGCATCAATGGCTAACTCAGTGGGTGAATGGAC
TGCATCGGCAGGTAAAACTGTCGGACAAATGTGGAACAATGTGACCAGTTCAATAACCAGCGTTTACGAA
AACGTGGCCGGTAACCTTGGCCGAACAGTAGGATCATCCGCTGCTGGTGAAAGTGGTCAGCTTGCTAAGG
AGACTATGAGTTCATTCGGGCTTGGTAAACTTAAGCAGATGGCCATGGAAAAAGCCTATGACCTGCTTCC
CGATACAGTTCGAGACTTCGTATTTAAAAATGTAGCGACAACGGGTGGAGAAATAGTCTTTTCTGCTGCT
GTTCAAAACTTTATGCTTGCATTAAATGTAATCGGCTGGATTTATACGGCATATCAAGTCACAAAAATGC
TGCTTGAAATGCTGGTGGCCTGCGATCAAAAAGAAATGGAAGCATCTATTCACAAAAATCAGAAATCCTG
TTTTACACTGGATACAAACCGTTGTGTTAAATATCTGAATCTGGGATTTACAAAGAAATGTGTTAAAAAA
GCAACAGACATGTGCTGTTACAATTCAATGTTATCTCGCGTTATTATGCAGCAGGCCTACCCGCAGCTTG
GAATAGACCCGGTTACTTCAAACTGCGTTGGCTTATCAATAGGGCAGATCCAAAAGTTAGATTTTGACAA
GATTGATTTAACAGAATGGATTAACGATGCTGTTCAGGTCGGAGAAGTACCGGACCAGTACGCTACATTC
TCAGAATCGTCAATAACAGCAAATTTGCCATTTAAAAACGAGAATTATCAACTTCCATCAGAAAGAACAA
AAGATGCAATGGGAGGAGAGGAGAATATGATAAAAGCCAGACAGGAAAACGCTCAGGCCATTAAAGAGGA
GAACGTAGACTGTAGCTATCTTCCACGCCCTGCGATTTGTGAAGTTGGGTCAACTTATGTAGATCCAATT
ACAGGTAAGGAAATACCAAAATATTAA
 Primer design