SecReT4
Protein ID: 160431734
T4SS name [ID]Tra_F [574]
Gene symboltrhI
Locus tagMAK1.21
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]25514..27370 [+]
Productputative DNA helicase
Component typeTraI_F
UniProt IDA8R6C7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam UvrD_C [PF13361], Evalue: 1.5e-39, Aligned region: 278..588
UvrD-helicase [PF00580], Evalue: 3.1e-28, Aligned region: 29..116
UvrD-helicase [PF00580], Evalue: 3.1e-28, Aligned region: 171..272
UvrD_C_2 [PF13538], Evalue: 3.4e-10, Aligned region: 520..586
AAA_19 [PF13245], Evalue: 5.3e-06, Aligned region: 37..109
Protein Sequence: 618 a.a.     [Download]
>gi|160431734|ref|YP_001551848.1| putative DNA helicase [Salmonella enterica subsp. enterica serovar Choleraesuis]
MSLVKKNPSNLNRIIKGTKYSEAFMGKPTDEQRVIIENANANNMVIAAPGSGKSFTMIEAVISILRQFPY
AKVGMVTFTRAATNSLAEKLKRRLSKKDQDRVLVNTFHGFIRMQLDMVNWKGKMLISSAQRSVIHRALKE
SGAPFRYPDAEFAIDAIGREMDTDIISVRHTRQQIHLFNTYQAICQKDHVADLNALSRFVVGQMYSGKMQ
PLNLTHLVVDEVQDTDSIQYAWISLHTRAGVNTSIVGDDDQAIYSFRASGGVKIFQQFEKQFRPNIFYLN
TCFRCEPEILKVAGALIEKNVYRYAKDLRSAKGGGGKVHFRSYVDMDEQIQGILNLINQDPIGWAILSRG
NAHLDQLESLIEQPVLRYGGKSFWDEKETSDVLHLMAFFRHSNDVRLMKRVLALFGENEEVLDQTALSMK
GRKVTFGELNIPNESSLETRTLHSNFTRFTQETREKVEIEKRFANLIKWMELSSIKMRTQKGSPSLSRIA
LDTCKQWAEKTGWQNMINRAAAMCLGPKKKDEEYTPDKVVLSTLHGSKGLEWKNVIIMSCNADQIPSKRS
VGQEAIEEERRLLFVGFTRAEQQLHVMWYGDPSFFLSECAEDKLKEAAKSRTESPLTE
 
Nucleotide Sequence: 1857 bp     [Download]
>gi|160431713|ref|NC_009981.1|:25514-27370 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGAGTCTTGTAAAGAAAAATCCGTCAAATTTAAATCGTATAATAAAGGGGACTAAATATTCAGAGGCTT
TTATGGGTAAACCAACAGATGAGCAAAGGGTCATCATTGAAAATGCAAATGCTAATAATATGGTTATTGC
AGCACCGGGATCTGGAAAGTCATTCACGATGATAGAGGCGGTGATCTCTATCCTCAGGCAGTTCCCTTAT
GCCAAAGTGGGGATGGTCACATTTACCCGTGCAGCAACAAATTCATTGGCTGAAAAACTGAAACGTCGAT
TAAGTAAGAAAGACCAGGATAGGGTGCTGGTCAATACATTCCACGGCTTTATCCGGATGCAACTGGATAT
GGTCAACTGGAAGGGCAAGATGTTGATTAGCTCGGCACAGCGTTCTGTAATTCACAGGGCATTGAAGGAG
TCCGGCGCGCCTTTTCGATACCCGGATGCAGAATTTGCTATTGACGCGATTGGAAGGGAAATGGATACGG
ACATCATTTCAGTTCGCCATACGCGGCAACAAATCCACTTGTTCAACACCTATCAGGCAATATGTCAGAA
AGACCACGTTGCAGATTTGAATGCACTCTCACGTTTTGTTGTGGGCCAGATGTACTCGGGGAAAATGCAG
CCACTTAACTTGACACATTTAGTTGTAGATGAAGTTCAGGATACCGACTCGATTCAGTATGCCTGGATCT
CACTACATACGAGGGCAGGTGTTAACACTAGCATCGTTGGGGATGATGATCAGGCAATTTATTCATTCAG
GGCATCAGGTGGAGTCAAAATATTCCAGCAGTTTGAAAAACAATTCAGGCCCAACATATTTTATTTGAAT
ACTTGTTTCAGATGTGAACCAGAGATTTTGAAGGTAGCAGGGGCATTGATTGAAAAAAATGTTTACAGAT
ACGCTAAAGATCTCCGTTCAGCTAAGGGCGGTGGGGGAAAAGTTCATTTCCGCTCATATGTTGATATGGA
TGAGCAAATTCAAGGCATTCTCAATCTGATTAACCAAGACCCGATTGGGTGGGCAATCCTCAGCAGAGGT
AATGCACATCTCGATCAGCTTGAAAGCCTGATAGAGCAGCCGGTACTTCGTTATGGTGGGAAGTCATTTT
GGGATGAAAAGGAGACAAGCGATGTATTGCATTTGATGGCATTCTTCCGACATTCCAACGATGTCCGGTT
AATGAAGAGGGTGCTGGCGCTTTTCGGTGAAAATGAAGAGGTCTTGGACCAGACAGCATTGAGCATGAAA
GGAAGAAAAGTAACTTTTGGTGAACTGAACATCCCGAATGAAAGTTCCCTGGAAACAAGAACGCTTCATT
CAAACTTCACCCGGTTTACACAGGAGACTCGGGAAAAGGTTGAAATAGAAAAAAGGTTCGCAAATCTGAT
TAAGTGGATGGAGTTGTCGTCGATAAAAATGAGGACGCAGAAAGGATCACCATCACTGAGCAGAATTGCG
CTGGATACCTGTAAGCAATGGGCCGAAAAGACAGGCTGGCAAAATATGATAAATCGAGCTGCGGCGATGT
GTCTGGGGCCAAAGAAGAAGGATGAGGAATATACACCGGATAAAGTAGTTTTATCGACGTTGCACGGTTC
GAAGGGTCTTGAATGGAAAAATGTAATTATTATGAGTTGTAATGCAGATCAGATTCCAAGTAAGCGGTCA
GTGGGGCAGGAGGCGATTGAAGAAGAAAGACGACTGCTTTTTGTTGGGTTTACACGAGCAGAGCAACAGC
TGCATGTAATGTGGTACGGTGATCCGTCTTTCTTTTTAAGCGAATGTGCTGAAGATAAATTGAAAGAGGC
TGCGAAAAGTAGAACAGAATCCCCTTTGACAGAATAA
 Primer design