SecReT4
Protein ID: 160431850
T4SS name [ID]Tra_F [574]
Gene symbol-
Locus tagMAK1.145
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]126302..126817 [+]
Producthypothetical protein
Component typeOrf169_F
UniProt IDA8R6Q8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 171 a.a.     [Download]
>gi|160431850|ref|YP_001551964.1| hypothetical protein MAK1.145 [Salmonella enterica subsp. enterica serovar Choleraesuis]
MFIPPVDDVKPIPVPVEIYTQCITDASRFFGIDAELVFTLFDNEGGKVGTFSRNKNGTYDIGPMQINSSN
LPEIRDHFPSVTWRVLAYDACASFWVGTWWLYRKIVDRKGNVFEGIADYNSKTPKVRATYIFNFMIKYNR
RIQRRNGMDELYQWTQPKPQYNGHIVKNLPE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|160431713|ref|NC_009981.1|:126302-126817 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
GTGTTTATACCACCAGTAGACGATGTGAAACCTATTCCCGTTCCTGTTGAGATCTACACGCAGTGCATTA
CCGATGCCTCCCGTTTTTTCGGGATTGATGCGGAGTTGGTCTTTACGCTTTTTGATAATGAGGGCGGAAA
AGTCGGGACGTTCAGCCGTAATAAAAATGGCACTTATGATATTGGGCCTATGCAGATCAATTCGTCCAAC
CTGCCAGAAATACGCGACCATTTTCCGTCTGTTACGTGGCGGGTGCTGGCCTATGACGCCTGTGCCAGTT
TCTGGGTGGGCACCTGGTGGCTTTACCGGAAGATTGTTGACCGGAAGGGTAACGTATTTGAAGGGATTGC
CGATTACAACAGCAAAACCCCTAAGGTCCGGGCGACGTATATCTTCAACTTCATGATCAAATACAATCGC
CGGATTCAGCGCCGAAATGGAATGGACGAATTATATCAGTGGACGCAACCTAAGCCCCAGTACAACGGGC
ATATTGTAAAAAATCTTCCTGAATAA
 Primer design