SecReT4
Protein ID: 160431851
T4SS name [ID]Tra_F [574]
Gene symbol-
Locus tagMAK1.147c
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]127727..131716 [-]
Producthypothetical protein
Component typeTraG_F
UniProt IDA8R6Q9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 5.3e-82, Aligned region: 4..500
Protein Sequence: 1329 a.a.     [Download]
>gi|160431851|ref|YP_001551965.1| hypothetical protein MAK1.147c [Salmonella enterica subsp. enterica serovar Choleraesuis]
MDYNIYTVGDIEFVWSALNGIALIFSQYTGVKAFLTTAAVLAGASLFYKTWLWLLNPTKAEVPIFSWILG
LILFSMAIVRVDVTIESVKSGEVRNVDGIPIFIAAMGTVTTNLSQGLLKDYKTAFDPLAPIDFAATTLDD
DITLGPMIRFVKFLQWGGDSQGYCSAFPEPASGLGAMNVCATVQSLAYNCLKGTQNSSAKIAGKETIFND
IFSANIVDSMERINQAMKGSLKNASANIVGVNSSKSATCEEVWSTVKQVTSTPEARQTIALIGQTNGILA
PDEAGGAASGASFTDVMASANGMYGKAIGAYDATLSLFIMNELRNGASKYKTPLGLASDMQLFEASLKRT
NTMASQGQLWLQLSGAAIAFLEMFAYMVAPFALLMLLALGGNGVAAAAKYLQLILFVNMWPITAVMVNAY
VKKVATADLDTWSTLNSQSNAVTWMGLPGLAETYSSYLSVASALYALIPVLTLFLMTQSIHPMMNAMKGV
TPPAPVDSSHLTPKVWDAPNSGKSSFGDVNRTALTSTGQGFSGGGAMDSSNFRLGTWNAGSSIASSQGQG
AAFTSSAMSAASNTFQQAFNQMSEVGRTGQSGQQFTSNLQSLKSFTDQAGANIANSVGAKHGINSQQLAG
VVSNLLLNGSLGLGGEEKLGKGGGGGLAQKVMDSLGIKAGGQVGSGITKSNSGNESLLTDLSKAITTQLT
ENSGLTDQMTKAAAQINSDQFAQTNAFKEAATKMNQSTQTMAENLSTSLSTNASANTGMTLDSRQAINLD
RFSDSIRNKNFSDEDVRNFARKNGLDENAFMEKFNSYNDTFKASTQLGSQLQRTDALVATTRDFSEQKIA
IDTARGETAESNKQDLRETSSLLKGLVADFGGNAQQMLPITNQLDRITGDASGINTIAQAQDRTPEHVNT
SSVMSADRVADVGQSMDAQAKAGLVQNHQNANQHVGGQTESGVTPYNVDKISKEDIQGIHQGNVNKSYSE
ENQNVLSSLEKNTPVVTNETVGRVQGAGVDVQHANQTFDQLQAGSGGKHATSGMGTISDKLNNMYGDNQI
RGISGNLPNYFGRIANDPTKKPDDKRAELAAQAVFTYGASTMATGAEKEQLKADTQNILSELSHYNVRWG
MNDLQNIHEGFNMHNKASGSLDSVVRANLGEGGSGGGLVGQRTQTTTDLLVGNKIESNTERGVIGSTLLS
GQESVARGLDVIGAKPVNDMLSGMGILTTPSSLANDASNPQNMPSSLLGKVGNHLQMSDGVSEVTSRYKD
MGGDGIKAYETASQNSERAIRQQLTDDPRFGPDKADAFVSFMKSNLNNTNEPYQSRIEKAKSWLNENKK
 
Nucleotide Sequence: 3990 bp     [Download]
>gi|160431713|ref|NC_009981.1|:c131716-127727 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGGATTACAACATCTATACAGTTGGCGATATTGAATTTGTGTGGTCCGCCCTGAACGGGATTGCCCTGA
TTTTCTCACAATACACCGGTGTAAAAGCATTTCTAACGACGGCAGCGGTACTGGCTGGAGCCAGCCTGTT
TTATAAAACGTGGCTTTGGCTGTTGAACCCGACAAAAGCAGAAGTGCCGATATTTTCATGGATTCTTGGG
CTGATTCTATTTTCGATGGCAATTGTTCGTGTGGATGTGACGATTGAATCAGTTAAGTCTGGTGAAGTGA
GAAATGTCGATGGCATTCCTATTTTTATTGCGGCGATGGGAACTGTCACCACGAACCTTAGCCAGGGCTT
ACTCAAAGACTACAAAACGGCATTTGATCCACTGGCGCCGATCGACTTTGCCGCAACGACGCTTGATGAT
GACATTACTCTTGGTCCGATGATTCGTTTCGTTAAATTCTTACAATGGGGTGGTGACAGCCAGGGCTATT
GTTCTGCGTTTCCCGAACCAGCCAGCGGGTTAGGTGCGATGAATGTGTGCGCGACAGTACAATCACTGGC
CTATAACTGTCTCAAGGGAACCCAAAACTCAAGCGCAAAAATTGCTGGGAAAGAAACCATTTTTAACGAT
ATTTTCTCTGCAAATATCGTGGATAGCATGGAACGCATTAATCAGGCGATGAAAGGTTCGCTGAAGAACG
CCTCTGCCAACATTGTCGGTGTGAATAGCTCAAAGTCTGCTACTTGTGAAGAGGTCTGGTCGACCGTTAA
ACAGGTAACGAGCACCCCAGAGGCTCGGCAGACGATTGCATTGATTGGGCAAACAAACGGTATCCTTGCT
CCAGATGAGGCGGGAGGTGCAGCATCAGGAGCGAGCTTCACGGATGTAATGGCGTCGGCGAATGGCATGT
ACGGCAAAGCTATTGGTGCTTATGACGCGACGCTTAGTTTGTTCATCATGAATGAACTCCGTAATGGTGC
CAGCAAGTACAAAACCCCACTCGGGCTGGCCTCGGATATGCAGTTGTTTGAGGCATCATTAAAGCGTACG
AATACCATGGCATCTCAGGGGCAGCTCTGGCTGCAATTGTCCGGTGCAGCCATCGCGTTTCTTGAGATGT
TTGCGTACATGGTTGCCCCATTTGCATTGCTCATGCTTTTGGCTCTCGGGGGAAATGGTGTGGCCGCTGC
TGCAAAATATCTCCAGCTTATTCTTTTCGTAAATATGTGGCCTATTACTGCGGTTATGGTGAATGCCTAC
GTGAAGAAAGTGGCGACCGCAGATCTTGATACATGGAGCACATTGAATAGTCAGAGTAACGCGGTGACAT
GGATGGGTTTGCCAGGGCTTGCCGAAACATACAGCTCTTATTTATCAGTAGCATCAGCACTCTATGCTCT
TATCCCTGTATTGACGCTGTTCCTGATGACGCAATCCATTCATCCAATGATGAACGCGATGAAAGGAGTC
ACACCACCAGCGCCAGTGGACTCCAGCCACCTCACGCCGAAAGTGTGGGATGCGCCAAACAGCGGAAAAT
CATCGTTTGGGGATGTGAATCGTACCGCGCTGACAAGCACCGGCCAAGGATTCAGTGGTGGCGGGGCCAT
GGACTCCAGTAATTTCCGACTCGGTACGTGGAATGCCGGTTCAAGTATCGCGTCAAGCCAGGGGCAAGGG
GCAGCATTTACCTCTTCAGCCATGAGCGCAGCAAGTAACACATTCCAGCAGGCCTTCAACCAGATGAGTG
AAGTTGGCCGAACGGGGCAATCAGGCCAGCAATTTACCTCCAACCTGCAAAGCTTGAAATCATTTACTGA
CCAGGCCGGTGCAAACATCGCGAATAGCGTAGGGGCGAAGCATGGAATTAATTCGCAGCAATTAGCTGGC
GTGGTGTCAAATCTTCTGCTCAATGGCAGTTTGGGACTTGGTGGTGAAGAAAAACTTGGAAAAGGAGGAG
GAGGAGGTCTCGCTCAGAAAGTAATGGATAGCCTAGGAATAAAAGCGGGGGGGCAAGTTGGATCAGGGAT
CACGAAAAGTAATTCTGGGAATGAAAGTCTCTTAACTGATTTGAGTAAAGCTATTACGACTCAATTGACT
GAAAACTCAGGACTGACTGACCAAATGACTAAAGCGGCTGCTCAGATAAACAGTGATCAGTTTGCACAGA
CCAATGCATTCAAAGAAGCTGCAACAAAAATGAACCAGTCCACACAGACAATGGCCGAAAACTTGTCGAC
GTCACTTTCAACGAACGCCAGCGCCAATACTGGCATGACACTCGACTCAAGACAGGCTATCAACCTGGAC
AGATTCTCCGATTCTATCCGTAATAAAAACTTTAGCGATGAAGATGTGCGTAATTTTGCACGGAAAAATG
GTCTTGATGAGAATGCCTTTATGGAGAAGTTCAATTCCTATAATGACACATTTAAGGCCAGCACTCAGTT
GGGTTCACAACTCCAACGTACAGATGCGCTGGTGGCAACGACACGTGACTTTAGTGAGCAAAAAATAGCG
ATTGATACTGCCCGAGGTGAAACGGCTGAGAGCAATAAACAGGATCTGCGTGAAACTTCCAGCCTGCTTA
AAGGGCTGGTTGCTGACTTTGGCGGTAACGCTCAACAGATGCTGCCGATTACTAATCAGCTTGACCGAAT
CACTGGTGATGCCTCGGGTATTAACACGATTGCACAGGCGCAGGATCGCACCCCAGAACATGTAAATACG
TCCAGCGTAATGAGCGCTGATCGTGTTGCTGACGTGGGGCAAAGTATGGATGCTCAGGCAAAAGCCGGGC
TGGTACAAAACCACCAAAATGCTAACCAGCATGTTGGTGGACAAACTGAGTCTGGTGTAACTCCGTACAA
TGTGGACAAGATCAGCAAAGAAGATATTCAGGGCATTCATCAAGGTAATGTAAATAAATCCTATAGCGAA
GAGAACCAGAATGTGCTCTCGTCATTGGAGAAGAATACCCCTGTTGTGACGAATGAAACTGTGGGAAGAG
TTCAGGGGGCTGGGGTGGACGTTCAGCACGCCAACCAAACTTTCGACCAGTTACAGGCTGGTTCGGGCGG
TAAGCATGCGACTTCGGGCATGGGTACTATCAGCGACAAACTGAATAATATGTACGGAGATAACCAGATA
CGCGGTATATCAGGCAACCTCCCGAATTATTTTGGCAGGATTGCAAATGATCCTACCAAAAAGCCGGATG
ACAAACGTGCGGAACTGGCCGCACAAGCTGTGTTTACCTATGGCGCCAGTACAATGGCAACCGGCGCTGA
GAAAGAACAACTGAAAGCGGATACTCAAAATATCCTCTCCGAACTGAGTCACTATAACGTTCGCTGGGGG
ATGAACGATCTCCAGAATATCCATGAAGGTTTCAACATGCATAACAAGGCTTCAGGTTCTCTTGACTCAG
TTGTGAGGGCGAATCTTGGGGAAGGTGGTTCTGGCGGCGGGCTCGTTGGGCAACGAACCCAAACCACGAC
GGATCTCCTTGTTGGTAATAAAATTGAGTCCAATACAGAACGTGGTGTTATTGGTAGTACGCTTTTATCG
GGGCAGGAGAGTGTTGCCAGAGGACTTGACGTTATCGGAGCTAAACCTGTAAACGACATGCTCTCAGGTA
TGGGTATCCTGACCACCCCTTCATCTTTGGCAAACGATGCTTCGAATCCACAAAATATGCCGAGCTCGCT
ATTGGGCAAGGTTGGAAATCACCTGCAAATGTCAGATGGTGTTAGCGAGGTGACCAGCAGGTATAAGGAT
ATGGGGGGGGATGGGATCAAGGCGTATGAGACTGCATCACAAAACTCAGAACGTGCGATTCGTCAGCAAC
TGACCGATGATCCACGTTTTGGGCCGGATAAAGCAGATGCATTCGTGAGCTTTATGAAGTCAAACCTGAA
TAATACAAATGAACCATATCAGTCGAGAATTGAGAAAGCTAAAAGCTGGCTGAATGAAAATAAGAAGTAA
 Primer design