SecReT4
Protein ID: 160431852
T4SS name [ID]Tra_F [574]
Gene symbol-
Locus tagMAK1.148c
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]131725..133140 [-]
Productputative pilus-assembly protein
Component typeTraH_F
UniProt IDA8R6R0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 8e-90, Aligned region: 33..398
Protein Sequence: 471 a.a.     [Download]
>gi|160431852|ref|YP_001551966.1| putative pilus-assembly protein [Salmonella enterica subsp. enterica serovar Choleraesuis]
MRADFHVCAKKLLLSLAVCTAMIAPNAVADNAMRNIFNGMMTTTSPASFETATRTGVVGGSFSYRTTNVN
TNLVSMSFPKASVGCNGIDVFLGSFSMINGDQLVQVARGIAQGAAIYAFNVAVSAICADCAATINDIQNK
LQALNKFAKDSCNATYSFLTENVGPPSQFANAVSSGPASMLGTLNGLLPDFGSSMTKSPETVTSQVKAKD
PEEFAEKFSGNLFYMSFMDIDKGSMNIGGVTELSGYRLAEQLMSLVGTVIINWDAKGEKAGMEVRPSTMT
VSDFIMGPPAGGSIKMLKCSPAPDPASARKSQCLVMSEVTDGGFKGLKDTISDLLIQVQTKAISDVRISD
DELRIISYIGIPTILDSLQTFDVPEGYAYIQDISAIAATSLVINMLRQVEAKISAMNIPSESLSGRRQDL
TRLSENLTNQVKAAYELTRSQVGNSSDVISAWDDRRLKRKAFMESLRGTGN
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|160431713|ref|NC_009981.1|:c133140-131725 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGCGCGCTGATTTCCATGTTTGTGCAAAAAAGTTACTTTTATCGTTAGCCGTTTGCACGGCGATGATTG
CGCCAAATGCCGTTGCCGATAACGCCATGCGTAATATTTTCAATGGCATGATGACGACTACGAGCCCAGC
TAGTTTTGAAACGGCCACCCGTACCGGAGTGGTTGGCGGCTCATTTTCCTACCGCACGACAAACGTGAAT
ACCAATTTAGTGTCAATGTCTTTTCCCAAAGCTTCCGTAGGCTGCAACGGAATCGATGTTTTCCTTGGTT
CCTTCAGTATGATTAACGGAGATCAGCTGGTTCAGGTTGCTCGCGGTATTGCACAGGGGGCTGCAATTTA
TGCATTCAATGTCGCGGTATCGGCAATCTGTGCTGACTGTGCTGCGACTATTAACGATATCCAGAATAAA
TTGCAGGCGCTGAATAAATTTGCCAAAGATTCATGCAACGCTACTTATTCGTTTCTTACTGAAAATGTTG
GTCCACCTAGCCAGTTTGCGAATGCTGTCAGTTCCGGCCCTGCTTCAATGCTTGGCACTCTTAATGGACT
GTTGCCTGATTTTGGTTCATCAATGACAAAGTCGCCGGAAACCGTGACTTCCCAGGTAAAAGCAAAAGAC
CCTGAAGAGTTTGCTGAAAAATTCAGTGGAAACCTTTTCTATATGTCATTTATGGACATCGATAAAGGGT
CAATGAATATCGGTGGCGTGACTGAGCTATCTGGCTACAGACTTGCTGAGCAGCTGATGTCGCTTGTCGG
TACTGTAATTATCAACTGGGACGCTAAAGGTGAAAAAGCGGGGATGGAAGTTCGCCCGTCGACGATGACG
GTATCGGATTTCATCATGGGCCCACCGGCTGGTGGTTCCATAAAAATGCTCAAATGTTCGCCTGCCCCCG
ATCCAGCTTCAGCTAGAAAGTCGCAATGCCTGGTTATGTCTGAAGTGACGGATGGTGGTTTCAAAGGTTT
GAAGGATACAATCTCGGACCTCCTTATTCAGGTTCAGACAAAGGCAATTAGTGATGTCAGGATCTCTGAT
GATGAATTACGCATTATTTCTTATATTGGCATCCCAACTATTCTTGATTCACTTCAGACGTTTGATGTCC
CTGAAGGCTACGCCTATATCCAGGATATCAGTGCGATAGCGGCCACCAGCCTTGTTATTAACATGCTTCG
GCAAGTTGAAGCAAAGATCAGCGCTATGAATATACCCAGCGAATCTCTTTCCGGGCGGCGGCAGGACCTG
ACTAGGTTATCTGAAAACCTGACCAATCAGGTAAAAGCTGCCTATGAGCTAACCCGTAGCCAGGTGGGCA
ACAGCTCTGACGTCATTTCTGCATGGGATGATCGCCGATTAAAGAGAAAAGCGTTCATGGAAAGTCTTCG
TGGCACAGGTAACTGA
 Primer design