SecReT4
Protein ID: 160431853
T4SS name [ID]Tra_F [574]
Gene symbol-
Locus tagMAK1.149c
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]133130..134176 [-]
Productputative pilus-assembly protein
Component typeTraF_F
UniProt IDA8R6R1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.9e-49, Aligned region: 45..267
Thioredoxin_2 [PF13098], Evalue: 2.5e-07, Aligned region: 174..265
Protein Sequence: 348 a.a.     [Download]
>gi|160431853|ref|YP_001551967.1| putative pilus-assembly protein [Salmonella enterica subsp. enterica serovar Choleraesuis]
MTRLTLIPSKMLVLLSLFITGVHANEEQALIKDTPFVSGQAFKKGFFWYDDPTRKTEEEITETKPPVASS
TQPEQEEKIELNSKWLKDNMPQLLTKAMDNPTPENLSRFYTAQRLMLDIGTRFSDKSKDYFLKNPMMSEK
RRQPVEKVALDAHRTVVEKNQQSVMKDIFTKSGLFFFFQSTCQFCHEESQILQFMENYYSVDILPVSMDG
RPLQNGLFQDFSVPNAQIIDQFKIREVPTIFLVSKDGSSAQRISEGMITAEELKNTIILAAKGMKLIDDA
SFQSTLDIKRQYTIGEDGVITVNKSEMDSDPFLLQRIMDKKLEGYDMPTADPVNYLNVGGSLGGAYAR
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|160431713|ref|NC_009981.1|:c134176-133130 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGACTCGATTAACGTTAATACCTTCAAAGATGTTAGTGCTGCTGTCTTTGTTTATTACTGGGGTCCATG
CAAATGAAGAGCAGGCCCTTATCAAAGACACTCCCTTTGTATCAGGACAGGCCTTCAAGAAAGGCTTTTT
CTGGTATGACGACCCGACAAGGAAAACTGAGGAAGAAATTACAGAGACCAAGCCTCCTGTTGCATCTTCG
ACCCAGCCAGAACAAGAAGAAAAGATTGAGCTTAATTCAAAGTGGCTAAAGGACAATATGCCTCAGCTTT
TGACCAAGGCTATGGATAATCCGACCCCTGAAAATTTATCGAGATTTTATACAGCACAACGTTTAATGCT
GGATATCGGTACGCGGTTTTCGGATAAATCGAAAGATTATTTCCTTAAAAATCCAATGATGTCTGAAAAA
CGCAGGCAACCGGTTGAAAAGGTAGCGCTCGATGCACATCGTACGGTGGTCGAGAAAAATCAGCAGTCGG
TTATGAAAGATATTTTCACTAAATCCGGGCTGTTTTTCTTTTTCCAGAGTACTTGTCAGTTCTGCCACGA
AGAAAGTCAAATACTCCAGTTTATGGAGAATTACTATTCTGTCGACATTCTTCCTGTCAGCATGGACGGC
AGACCACTACAGAATGGGTTGTTCCAGGATTTCTCTGTACCTAATGCGCAGATTATTGATCAATTTAAAA
TCCGTGAAGTTCCAACTATTTTCCTTGTCTCAAAAGATGGGTCATCAGCGCAACGAATAAGCGAAGGCAT
GATCACTGCTGAGGAGCTCAAGAATACTATTATTCTGGCTGCAAAAGGCATGAAGCTGATTGATGATGCC
TCTTTCCAGTCCACTTTAGATATTAAGCGCCAATATACCATTGGCGAGGATGGCGTAATTACTGTGAATA
AATCAGAAATGGACTCTGACCCGTTCTTATTGCAACGAATAATGGATAAGAAACTGGAAGGGTACGATAT
GCCAACGGCGGACCCAGTGAACTATCTGAATGTGGGTGGAAGTTTAGGAGGTGCATATGCGCGCTGA
 Primer design