SecReT4
Protein ID: 160431859
T4SS name [ID]Tra_F [574]
Gene symbol-
Locus tagMAK1.155
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]141213..143195 [+]
Producthypothetical protein
Component typeTraD_F
UniProt IDA8R6R7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.1e-16, Aligned region: 165..550
TrwB_AAD_bind [PF10412], Evalue: 9.6e-14, Aligned region: 399..606
TraG-D_C [PF12696], Evalue: 2.4e-09, Aligned region: 471..583
Protein Sequence: 660 a.a.     [Download]
>gi|160431859|ref|YP_001551973.1| hypothetical protein MAK1.155 [Salmonella enterica subsp. enterica serovar Choleraesuis]
MLVMGFRSDGVNIAPIILYTAVFLLLVCLYRCKTAHPYLMAHWRVFQRQIMFISLKSLRTINKSNFFSNE
RKYRQLVQEYKKNNRPVPDRKTYFCNGFEWGPEHADRAYQIANLSSDKREIALPFVLSPIARHFETMARS
MGGNNAIFAVDRRAPIFVTEDNWFGHTLITGNVGTGKTVLQRLLSISMLHLGHVIVVIDPKNDAEWRQSL
MDEASELGLPFYKFHPAQPSSSVCIDVCNAYTNVSDLTSRLLSLVSVPGEVNPFVQYAEALVSTVITGLS
YTDKKPSIYLIHKNMKSHMSVVNLTIKVMECCFARHYGPDVWMEKVKYASNDTLQVRFKRLTEWFNAHFL
NYEGAEPIEWIDTVGRLVDYSMSDPEHMSKMTAGIMPLFSRLTEQPLNELLSPSPNTLTSREIVTSDGMF
STGGVLYISLDGLSNPESARAISQLIMSDLTSCAGSRYNADDGDMSSHSRISIFVDEAHSAINNSMINLL
AQGRAAQIALFICTQTISDFIAAANAETANRITGLCNNYISLRVNDTPTQTLVVENFGKSPISTNMVTYT
TGSETTLPHNNFSGSISERKQTTLEESIPKELLGQVPKFHIVARLQDGRKVVGQIPIAVSEKAMKPNTTL
LEMFLKPAGKVTLRQNVGLSYLNKYLRKLH
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|160431713|ref|NC_009981.1|:141213-143195 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGCTGGTTATGGGCTTTCGTTCAGATGGGGTGAATATTGCCCCTATCATTCTTTATACCGCTGTTTTCC
TGCTTTTGGTTTGTTTGTACCGTTGTAAAACGGCACACCCCTATTTGATGGCACACTGGCGCGTATTTCA
GCGCCAGATAATGTTTATTAGCCTCAAGTCGCTCAGGACGATCAATAAAAGTAACTTTTTCTCGAACGAG
CGAAAGTATCGCCAGCTGGTACAAGAGTATAAAAAAAATAACCGACCAGTACCGGATAGAAAAACCTACT
TTTGTAACGGCTTTGAATGGGGTCCCGAGCATGCAGACCGCGCATATCAAATTGCTAATCTCTCAAGTGA
CAAAAGAGAGATAGCCCTGCCATTTGTTCTAAGCCCTATAGCGCGACATTTTGAAACAATGGCCAGATCC
ATGGGGGGCAATAACGCCATCTTTGCTGTTGACCGGCGGGCACCCATTTTTGTGACCGAAGATAACTGGT
TCGGACATACCCTCATTACCGGAAACGTCGGTACCGGTAAAACGGTACTTCAGCGCTTACTGAGCATCAG
CATGCTGCATTTGGGCCATGTCATTGTGGTTATTGACCCGAAGAATGACGCTGAGTGGCGACAGTCACTG
ATGGATGAAGCGTCAGAACTGGGGTTGCCATTTTATAAATTTCACCCAGCCCAGCCGTCTTCATCGGTGT
GTATTGATGTATGCAATGCTTACACAAATGTTTCGGACCTCACCTCACGACTTCTTAGTCTGGTTTCGGT
TCCCGGGGAAGTTAACCCATTCGTGCAATATGCCGAAGCTCTCGTCTCAACGGTGATCACTGGTCTGTCT
TACACGGATAAAAAACCGTCGATATATCTCATCCACAAAAACATGAAAAGCCATATGTCTGTTGTGAACC
TAACGATAAAAGTAATGGAATGCTGCTTTGCACGACACTACGGGCCTGATGTCTGGATGGAAAAGGTGAA
ATACGCTTCGAATGACACTCTTCAGGTTCGATTTAAGCGCCTGACAGAATGGTTTAATGCCCATTTTCTT
AATTATGAAGGCGCCGAGCCCATTGAATGGATTGATACCGTCGGTCGGTTAGTGGATTACTCCATGTCTG
ATCCTGAACACATGTCTAAAATGACGGCGGGTATTATGCCGCTATTTAGTCGACTGACTGAACAACCACT
GAATGAATTGCTTTCGCCGTCTCCTAATACACTCACTTCGCGTGAAATAGTCACTTCAGATGGGATGTTC
AGTACCGGCGGAGTTCTGTATATCTCGCTCGATGGCCTTTCCAACCCGGAATCAGCCCGGGCCATTTCGC
AGTTGATAATGTCAGATCTTACGTCTTGTGCGGGTAGTCGTTATAACGCTGACGATGGTGATATGTCTTC
CCATTCAAGAATCAGTATTTTCGTCGACGAAGCACACTCTGCCATAAACAATTCAATGATAAACTTACTC
GCACAGGGTCGTGCCGCTCAAATTGCATTATTTATCTGCACGCAAACTATTTCCGACTTTATTGCAGCAG
CGAACGCTGAGACGGCAAACCGTATTACAGGTCTATGTAACAACTACATTAGCCTGCGGGTAAACGACAC
ACCAACACAAACGCTGGTCGTAGAAAACTTTGGTAAGAGTCCAATTAGTACAAATATGGTCACGTATACG
ACAGGATCTGAAACCACTTTGCCGCATAATAACTTCTCTGGGTCAATATCAGAAAGAAAGCAAACAACGC
TGGAAGAAAGTATTCCAAAAGAGCTTTTGGGCCAGGTCCCCAAATTCCATATTGTGGCCAGACTTCAGGA
TGGTCGTAAAGTTGTCGGGCAGATCCCGATTGCCGTAAGTGAAAAAGCGATGAAACCCAATACGACGTTA
CTGGAGATGTTCCTGAAACCCGCCGGAAAAGTAACTTTGCGCCAGAATGTGGGTTTAAGCTATTTAAATA
AATATCTAAGGAAATTGCATTGA
 Primer design