SecReT4
Protein ID: 160431926
T4SS name [ID]Tra_F [574]
Gene symboltrhA
Locus tagMAK1.227
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]195510..195863 [+]
Productputative pilin precursor
Component typeTraA_F
UniProt IDA8R6Y4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 117 a.a.     [Download]
>gi|160431926|ref|YP_001552040.1| putative pilin precursor [Salmonella enterica subsp. enterica serovar Choleraesuis]
MELTLNTNVERGKTNAFAFLKSKHAKVPLFILLVLANCSFAYAGSDDGAFGDIWAYMSEALTGAPGKIIA
CGMLFSVAYFGVVKPNLGLALVSALMMLVMANGEKIISSFLDAGIPL
 
Nucleotide Sequence: 354 bp     [Download]
>gi|160431713|ref|NC_009981.1|:195510-195863 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGGAACTGACATTGAATACTAACGTTGAAAGAGGAAAAACTAACGCTTTTGCATTTTTGAAGTCCAAAC
ATGCAAAAGTGCCTTTGTTTATTCTCTTGGTTTTAGCAAATTGCAGTTTTGCGTACGCGGGTTCCGATGA
TGGAGCCTTCGGCGATATCTGGGCCTACATGAGCGAAGCCTTGACTGGTGCGCCGGGTAAAATCATCGCG
TGCGGCATGTTGTTCTCGGTGGCTTATTTCGGCGTTGTAAAACCTAACCTTGGTTTGGCGCTGGTATCAG
CATTAATGATGCTGGTTATGGCAAACGGTGAAAAAATTATCAGCTCGTTCCTGGATGCTGGTATTCCTCT
GTGA
 Primer design