SecReT4
Protein ID: 160431927
T4SS name [ID]Tra_F [574]
Gene symboltrhL
Locus tagMAK1.228
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]195882..196232 [+]
Productputative plasmid transfer protein
Component typeTraL_F
UniProt IDA8R6Y5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2e-08, Aligned region: 22..93
Protein Sequence: 116 a.a.     [Download]
>gi|160431927|ref|YP_001552041.1| putative plasmid transfer protein [Salmonella enterica subsp. enterica serovar Choleraesuis]
MRGIFPLCGVFMTSQYEIPPHTYRFPYRINMPLLILFWDAKQLGITFVTIASGNIFDFFITSVVVAVVFW
FAYKKAAEEGIRGKLKHKLWWYGFFPGKSVFSSRYFTDPFIRNLYS
 
Nucleotide Sequence: 351 bp     [Download]
>gi|160431713|ref|NC_009981.1|:195882-196232 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGAGGGGGATATTCCCCCTCTGTGGAGTTTTTATGACAAGCCAGTACGAGATACCGCCACATACATATC
GCTTTCCATACAGAATAAATATGCCGTTACTAATTCTATTCTGGGATGCAAAGCAATTGGGTATAACATT
CGTGACTATCGCGAGCGGTAATATTTTTGATTTCTTTATAACTTCGGTAGTTGTGGCGGTGGTGTTCTGG
TTTGCATATAAGAAAGCAGCAGAGGAAGGGATTAGAGGAAAACTAAAACACAAACTGTGGTGGTACGGCT
TTTTTCCTGGAAAATCGGTGTTTAGTAGTCGTTACTTTACCGATCCATTTATCAGAAACCTCTATTCTTG
A
 Primer design