SecReT4
Protein ID: 160431928
T4SS name [ID]Tra_F [574]
Gene symboltrhE
Locus tagMAK1.229
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]196232..197029 [+]
Productputative pilus assembly protein
Component typeTraE_F
UniProt IDA8R6Y6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 8.4e-10, Aligned region: 71..201
Protein Sequence: 265 a.a.     [Download]
>gi|160431928|ref|YP_001552042.1| putative pilus assembly protein [Salmonella enterica subsp. enterica serovar Choleraesuis]
MELRMKLLSRLKIPFIKNSSNGDFDNKDETSQKGGEEVKGSFLDSKARFSKEIEGSEIGITYSALIKRDE
KLLRVNTVAMIIIGVLVVKNQFLTDPVTIVLPPNMTEEVKVVGNKASESYKTQWALFFSTLIGNINPTNI
GFVTTTILDALSPDLQAKTRESLQQQTNIMQARGVEQSFKPIDMYYDTKNDMVYVWGTKSTRLINVPDKT
ESSKWTFEWVLGMKNGRPRIAYVNQYSGTPNIKKITINGKEQLATLDNPPPSIGN
 
Nucleotide Sequence: 798 bp     [Download]
>gi|160431713|ref|NC_009981.1|:196232-197029 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGGAGCTAAGAATGAAACTTCTCAGCAGGTTAAAAATTCCATTCATTAAAAATTCCAGTAATGGCGATT
TTGATAACAAGGATGAGACTTCGCAAAAAGGAGGTGAAGAAGTAAAAGGAAGTTTTCTGGATTCAAAAGC
ACGCTTTAGTAAAGAAATTGAAGGTTCTGAAATTGGAATTACATATAGTGCATTGATTAAACGCGACGAA
AAACTCCTACGTGTGAATACAGTTGCAATGATCATTATTGGGGTTCTGGTTGTAAAAAATCAATTTCTCA
CTGATCCTGTGACTATAGTGCTACCGCCAAATATGACGGAAGAAGTCAAAGTTGTTGGAAATAAAGCCTC
AGAATCATATAAAACGCAGTGGGCCTTATTCTTTAGTACTTTGATTGGAAACATAAACCCAACAAACATC
GGTTTTGTTACAACAACTATATTGGATGCGCTTTCTCCGGATTTACAGGCAAAGACCCGGGAATCACTAC
AGCAGCAAACCAATATAATGCAGGCTCGTGGTGTAGAGCAGTCATTTAAGCCGATCGATATGTATTACGA
CACCAAAAATGACATGGTCTATGTCTGGGGAACAAAGTCAACTCGTTTGATTAATGTTCCGGACAAAACT
GAATCATCCAAATGGACGTTTGAATGGGTCCTGGGAATGAAAAATGGACGACCGCGCATAGCCTATGTGA
ACCAGTATTCAGGTACACCAAATATTAAGAAAATTACAATCAACGGCAAAGAACAACTGGCAACACTCGA
TAATCCGCCGCCGTCAATAGGTAACTAA
 Primer design