SecReT4
Protein ID: 160431929
T4SS name [ID]Tra_F [574]
Gene symbol-
Locus tagMAK1.230
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]197032..198264 [+]
Productputative periplasmic protein
Component typeTraK_F
UniProt IDA8R6Y7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 3.7e-11, Aligned region: 151..388
Protein Sequence: 410 a.a.     [Download]
>gi|160431929|ref|YP_001552043.1| putative periplasmic protein [Salmonella enterica subsp. enterica serovar Choleraesuis]
MTSKKVFHCTAITAVILLATSNVVFAEDYQLPATVNNPVVMPVGADEFQNGVKNAIIKDTGTTTETVQAT
KPTTALPSLSPASSASPAVNEITGALSNNPTLAGYQQQVKSGNFDSYGRPAGKEPQQNAQSTGSPSKADE
LYVEARNRYKEVQRVNVPPGGNIVLPVSRGLQNRISTSFKNASVSTSTPADEASIFVNGGDVFISTNTDK
PIGIMLSEDSVPESTYNLTLVPLDVPGAMISVTTSLSPTMQAKRETSLDKQNYDEMLARSQSEELTPSDP
RQDDHKQRIIDLLTPVALGEVPSGFSLQEDRLSRIPSSEQSPCNFNMYAKLGQRLVGSRELIDVVLVKND
KPYGQVVADQQCITEGVVASALFDKAFLQPGEETELYIVRDKLFKERQTRVTTRPSLIKR
 
Nucleotide Sequence: 1233 bp     [Download]
>gi|160431713|ref|NC_009981.1|:197032-198264 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGACTTCAAAAAAGGTTTTTCACTGCACCGCGATTACAGCAGTGATTTTGCTGGCAACTTCGAATGTGG
TATTTGCTGAAGACTATCAGTTACCGGCGACAGTAAATAATCCGGTAGTTATGCCTGTCGGGGCCGATGA
ATTTCAGAACGGTGTGAAAAATGCGATAATTAAAGACACTGGCACTACGACTGAGACCGTACAAGCAACA
AAACCGACAACTGCTCTGCCAAGTCTTTCACCTGCAAGCAGTGCTTCTCCCGCAGTCAATGAAATAACCG
GGGCGTTGTCAAATAACCCTACTCTAGCTGGTTACCAGCAACAGGTTAAATCAGGAAATTTTGATAGTTA
CGGAAGACCAGCAGGGAAAGAACCTCAACAAAATGCACAAAGTACCGGGTCCCCTTCAAAGGCAGATGAA
CTTTATGTTGAAGCACGTAATCGCTATAAAGAAGTACAACGAGTAAACGTTCCGCCTGGTGGCAATATTG
TACTCCCGGTTTCTCGGGGGCTGCAAAACAGAATTTCGACTTCATTTAAAAATGCATCTGTAAGTACTTC
AACGCCAGCTGATGAAGCCAGTATTTTCGTTAATGGCGGGGATGTTTTTATTTCAACAAATACAGATAAG
CCTATAGGAATTATGCTTTCAGAAGATTCAGTTCCTGAATCTACTTATAACCTGACACTGGTTCCACTGG
ATGTACCAGGGGCCATGATTTCAGTAACAACTTCTTTGAGCCCGACAATGCAGGCAAAACGAGAAACTTC
TCTTGATAAACAAAATTATGATGAGATGCTGGCACGCTCACAATCAGAAGAGTTGACTCCTTCAGACCCT
CGGCAGGATGACCATAAACAGCGGATCATTGATTTGTTGACTCCGGTTGCACTGGGTGAGGTTCCTTCTG
GTTTCAGTTTACAAGAAGACCGCTTGTCACGCATACCAAGCTCAGAGCAGTCCCCATGTAATTTCAATAT
GTACGCCAAGTTAGGTCAAAGACTGGTGGGATCTCGGGAATTGATAGATGTCGTTCTTGTTAAGAATGAT
AAGCCTTACGGACAGGTAGTGGCTGATCAGCAATGTATAACTGAAGGCGTGGTTGCAAGCGCTCTATTCG
ATAAAGCATTCCTTCAGCCCGGGGAAGAGACCGAACTTTATATTGTGCGGGATAAATTATTTAAAGAGCG
TCAGACTCGTGTTACTACGCGCCCAAGCCTGATTAAAAGATAA
 Primer design