SecReT4
Protein ID: 160431931
T4SS name [ID]Tra_F [574]
Gene symboltrhB
Locus tagMAK1.232
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]198696..200054 [+]
Productputative plasmid transfer protein
Component typeTraB_F
UniProt IDA8R6Y9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.5e-39, Aligned region: 240..444
Protein Sequence: 452 a.a.     [Download]
>gi|160431931|ref|YP_001552045.1| putative plasmid transfer protein [Salmonella enterica subsp. enterica serovar Choleraesuis]
MDIKKAWENKTVRISVIGAALMVLIVVISQSIFTTPVKKEKKTQKKDMQTGFLIDDSQMNKLSNEESQKT
YNEMVRQNRIDQNAAKADRDKAEKAQQENKAQIASLASQVQQLTTQLTEMQTSRNGNRNLDAGGPRNNVN
EQAPAKPYQLNPNAAVNGVSSGYAPISPTRNSPMRTITQSSIKTNGTDGVIQVMPISENRIREGREVVAG
SEKAPTRTIRGDGTAPVDSKARHAARKDEMFLPATSIITGVLITGLEAPTSLSSKAEPMPVTMRIKKDII
MPNNYTMDLRDCNLLGSAVGDLASQRAYIRATSISCVNSKGKAFDVIVEAYAVSENDGKNGIRGNLISRN
GNAIAGSAFAGGLSALAGSLSPSKVSSLNIDPNSTAQYQSPNIGALGALAGAGAAQGGLNRLVDYYTSIA
EQQWPIVEISPGRPITFVVQKGATIPTNLTSR
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|160431713|ref|NC_009981.1|:198696-200054 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGGACATTAAAAAGGCCTGGGAAAATAAAACTGTCAGAATCTCAGTAATTGGTGCTGCATTGATGGTAT
TGATTGTTGTCATCAGTCAATCAATCTTTACCACACCAGTTAAAAAAGAGAAGAAAACCCAGAAAAAAGA
TATGCAAACTGGATTCCTTATTGATGATTCACAAATGAACAAGCTGAGTAATGAGGAAAGCCAGAAGACT
TATAACGAAATGGTAAGGCAGAACCGTATTGACCAGAACGCTGCCAAGGCTGACCGTGACAAAGCTGAAA
AGGCTCAGCAAGAAAACAAAGCACAGATAGCCAGTCTTGCTTCGCAAGTTCAGCAACTCACTACGCAGTT
GACTGAAATGCAGACCTCAAGAAATGGTAATCGCAATCTCGATGCAGGCGGACCACGCAACAACGTCAAT
GAACAAGCCCCAGCAAAGCCATACCAGCTTAATCCAAATGCAGCGGTGAACGGGGTTAGTTCTGGATACG
CACCTATATCTCCGACCCGAAACAGTCCAATGCGGACAATAACACAGAGTTCAATTAAGACAAACGGCAC
TGATGGTGTCATTCAGGTGATGCCGATATCAGAGAACCGGATCAGAGAGGGGCGCGAGGTTGTTGCGGGA
AGTGAAAAGGCCCCAACGCGAACTATTCGCGGCGATGGGACTGCACCTGTTGATAGTAAAGCTCGTCATG
CGGCCCGTAAGGATGAAATGTTTCTTCCAGCGACGTCAATTATTACTGGGGTGCTAATTACCGGGCTGGA
AGCTCCAACGAGTTTGTCCTCTAAAGCAGAACCGATGCCGGTTACCATGCGCATTAAAAAAGACATCATC
ATGCCTAACAATTACACGATGGATTTGCGTGATTGTAATTTATTGGGTTCTGCTGTGGGGGATCTGGCAT
CTCAGCGTGCGTACATTAGGGCAACCTCCATATCGTGTGTCAACTCGAAAGGAAAAGCATTCGACGTAAT
AGTGGAAGCTTATGCGGTTAGTGAAAATGACGGGAAAAATGGCATTCGTGGGAATCTGATAAGCAGAAAT
GGAAATGCGATTGCAGGTTCTGCGTTTGCAGGAGGGCTGTCAGCATTGGCGGGGAGTCTGAGTCCATCAA
AGGTGTCTTCGCTTAATATAGATCCAAACTCTACGGCACAATACCAATCGCCAAACATAGGTGCATTAGG
AGCGCTGGCCGGAGCCGGTGCAGCTCAGGGGGGGCTAAACCGTCTTGTGGACTACTATACGTCAATAGCT
GAGCAGCAGTGGCCAATTGTAGAAATTAGCCCAGGGCGCCCAATTACTTTTGTCGTTCAAAAAGGGGCGA
CAATACCTACAAACCTGACAAGCCGCTGA
 Primer design