SecReT4
Protein ID: 160431934
T4SS name [ID]Tra_F [574]
Gene symboltrhV
Locus tagMAK1.235
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]201443..202393 [+]
Productputative plasmid transfer protein
Component typeTraV_F
UniProt IDA8R6Z2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 2e-11, Aligned region: 28..271
Protein Sequence: 316 a.a.     [Download]
>gi|160431934|ref|YP_001552048.1| putative plasmid transfer protein [Salmonella enterica subsp. enterica serovar Choleraesuis]
MNIKKVIFSALVVGSSSYLAGCTIGSAESECPGIEKGVICKGPREVMELTNNRDDLSGLGEEEANSGKGK
SAVNDSQYPAQLTPPGAVQYPKSSVLVNKPVTYTTTEVKPVGQLPVMYDQTLKMGAPTSTIGPRPISGNP
VNSNVRMTTSYNSNGSSVNPFLHPSAEVVKKTTQVVTPAPAPRYVAPNSDINASKDLYSINNGQPVNPTL
SSGQVQQYRTQGYKQAVVAPEPLAVLQQGRVMRITFAPYTDDNDALNLPGFVYVNVKPQTWIAGKNSTSN
PARIVPLEVQDAARENMQQQQRATKAVSSNGIVRQL
 
Nucleotide Sequence: 951 bp     [Download]
>gi|160431713|ref|NC_009981.1|:201443-202393 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGAACATTAAAAAAGTTATTTTCAGCGCTCTGGTTGTTGGTTCATCTTCATACCTGGCGGGTTGTACTA
TTGGCAGCGCAGAATCTGAATGCCCGGGAATTGAAAAAGGAGTTATTTGTAAAGGCCCGCGTGAAGTTAT
GGAACTGACGAACAATCGTGATGATCTCTCCGGCCTTGGGGAGGAAGAGGCTAATTCGGGAAAGGGGAAA
TCGGCTGTCAATGACAGCCAGTACCCTGCCCAACTAACGCCGCCTGGCGCAGTGCAGTACCCCAAGTCGT
CTGTACTTGTTAATAAGCCAGTGACATACACAACGACGGAAGTAAAACCGGTTGGACAGCTCCCGGTGAT
GTATGATCAGACATTAAAAATGGGGGCGCCAACTTCAACAATTGGACCACGGCCAATCAGCGGGAATCCT
GTTAATTCTAATGTACGGATGACAACGAGTTACAACTCAAATGGGTCATCCGTTAACCCCTTTTTGCATC
CGTCTGCTGAAGTCGTGAAAAAAACAACTCAGGTTGTTACTCCCGCGCCTGCTCCGCGCTATGTAGCACC
AAATTCTGATATCAATGCAAGTAAAGACCTTTATTCCATTAACAATGGACAGCCAGTAAACCCTACGCTC
AGCTCTGGGCAGGTACAGCAATACCGTACACAAGGTTACAAACAGGCAGTCGTTGCACCAGAGCCTCTTG
CTGTGCTTCAGCAAGGCCGCGTCATGAGAATCACCTTTGCACCATATACGGATGATAATGACGCGCTAAA
TCTGCCTGGCTTTGTTTATGTGAATGTCAAACCGCAAACTTGGATTGCGGGCAAAAATTCAACATCAAAT
CCGGCACGAATTGTTCCTTTGGAAGTCCAGGATGCGGCTCGTGAAAATATGCAACAGCAACAGCGAGCAA
CGAAAGCAGTTTCGTCAAACGGTATTGTGAGACAACTCTGA
 Primer design