SecReT4
Protein ID: 160431935
T4SS name [ID]Tra_F [574]
Gene symboltrhC
Locus tagMAK1.236
StrainSalmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1 (NC_009981)
Repliconplasmid pMAK1 [GenBank: NC_009981] [Browse all T4SS(s) in this replicon]
Location [Strand]202402..205083 [+]
Productplasmid transfer protein
Component typeTraC_F
UniProt IDA8R6Z3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.7e-60, Aligned region: 456..812
TraC_F_IV [PF11130], Evalue: 8.2e-46, Aligned region: 13..258
Protein Sequence: 893 a.a.     [Download]
>gi|160431935|ref|YP_001552049.1| plasmid transfer protein [Salmonella enterica subsp. enterica serovar Choleraesuis]
MRSANVYNKELSRHQLGGFIPVYDQIPGTHYFLLDGNRLGFMFICSPSPGVFDNQQDVLTELFKMDFPAD
TICQTSLTALPDLILHLSAWSAVRGGRMEGHDKLKGDLLTAYQLDYYDRSLNEPLKPDHDKLMLRDFQVW
ISFSIPLKSALPSEIEKTRIDALYSDLISKLNTVGLFPHKVGAENWLYCMDKLLHPGKTSRWSEGHVEAS
TMRRLNEQINVPGRKYTVTENHFSSTTQSNDISEHRYFKQLSVVKFPEFVNFGCMYELVVNWLNGRKTIF
SPFMITQTVHFADPLKLSRENVRYKAITNKQASIPTVLTFCPRLKDMDNDYMTITRELEDGARLLHSYLT
FTVMGNSAVDVQSAADQLKSFYLESRVNVADDSYIVFPSFVSSLPMCNDPKTILELDRFEVVSNTGAAHM
TPIFGPWKGNTDRPVLNLVSREGQLLGLDIFKTSASYNMVVGATSGAGKSFWVAYIINNYLGAGPRSNNL
IHYRDTFEGFKNNSYDAFDPDGAQIFVVDVGRSYQGISEQYTNSQFIDFGKKPDFTLNPFAFLTDVTVGE
RVFDEAPVFNDDSNNHDDDKDKVAQTIMVLNQLKIMASEKGNIDDFQQSVMLQLISEEYNESRKVGRTGS
ITGFARRCSNHEDKRIKDIGDQLGQWCEGGIYGNRFTENLPPINFDSRFIVLELEELKGTPHLQTVVLMS
IIQAAQHAMFIKKDGRRRLFILDEAWEYIRPDNASGSSNHSNQFFSSFLEAAWRRFRKTNCAGICITQSF
EDYFTSSVGRALTANSPWKIIMKQEKESIEAMKVNNYFSTTDAEYERMKNIRTVKRAFSEMLVRFENFQE
ICRLYVDRKMELCFTTDSTDRGKLWEIQSRLDCSYGEAIEILYEQEVASKSAA
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|160431713|ref|NC_009981.1|:202402-205083 Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence
ATGAGATCAGCTAACGTCTATAATAAAGAATTAAGCCGTCATCAGTTAGGTGGATTTATTCCCGTGTATG
ATCAGATTCCGGGTACACATTATTTTCTACTTGACGGAAACCGACTCGGTTTTATGTTTATCTGTAGTCC
GTCGCCCGGTGTCTTTGATAATCAGCAGGATGTGTTAACTGAATTATTTAAAATGGACTTCCCAGCTGAC
ACCATCTGTCAGACCTCATTAACTGCGCTGCCAGACTTGATCTTGCACTTAAGTGCCTGGTCTGCCGTTC
GTGGTGGTCGAATGGAAGGTCATGATAAGCTTAAGGGGGATTTACTCACTGCATATCAACTGGATTATTA
TGACCGAAGCCTGAATGAACCTTTGAAGCCGGACCACGATAAATTGATGCTTCGAGATTTTCAGGTCTGG
ATTTCCTTTTCAATTCCATTGAAGTCAGCACTTCCTTCTGAAATAGAAAAGACTCGCATTGATGCGCTTT
ACTCTGACTTAATCAGTAAGTTGAATACAGTAGGCCTTTTCCCACACAAAGTTGGTGCTGAAAATTGGCT
TTATTGCATGGATAAGTTATTGCATCCGGGAAAAACATCGCGTTGGTCTGAAGGTCATGTTGAAGCTAGC
ACCATGAGACGCCTAAACGAGCAGATCAATGTACCGGGTCGAAAATATACAGTGACAGAGAATCATTTCT
CATCTACAACGCAGAGCAATGATATTTCTGAGCATCGTTATTTCAAACAATTATCAGTAGTGAAGTTTCC
AGAATTTGTAAACTTTGGCTGCATGTATGAACTTGTAGTTAATTGGTTGAATGGACGTAAAACGATCTTT
AGCCCTTTCATGATAACCCAGACTGTCCATTTCGCCGATCCTTTAAAATTATCAAGAGAAAACGTCAGAT
ATAAGGCAATTACTAACAAACAAGCCAGTATTCCAACAGTTTTGACGTTTTGTCCAAGATTAAAGGATAT
GGATAATGATTACATGACGATAACACGCGAACTGGAAGATGGGGCTCGCCTCCTACACAGTTATCTGACA
TTTACTGTAATGGGGAATTCAGCAGTTGATGTTCAGTCTGCCGCAGACCAGTTAAAATCATTTTATCTGG
AAAGTCGTGTTAATGTTGCTGATGACTCGTACATAGTATTTCCCTCATTTGTTTCAAGCCTGCCGATGTG
TAATGACCCAAAGACAATACTAGAACTGGATCGTTTTGAGGTCGTGAGTAATACTGGTGCTGCGCACATG
ACCCCCATATTTGGTCCTTGGAAAGGTAATACGGACAGACCCGTACTTAACCTTGTCTCACGAGAAGGAC
AGCTGTTGGGGCTGGATATCTTCAAGACTTCTGCCAGCTATAACATGGTCGTTGGTGCAACGTCTGGTGC
TGGTAAATCATTCTGGGTCGCATACATCATTAATAATTATCTAGGCGCAGGTCCGCGTTCTAATAATCTG
ATCCATTATCGAGATACTTTTGAGGGATTCAAAAACAATTCTTATGATGCATTTGACCCTGATGGAGCCC
AGATTTTCGTAGTTGATGTCGGACGCTCATACCAAGGTATTTCGGAACAATATACTAATAGTCAGTTTAT
AGACTTTGGGAAAAAGCCTGATTTTACGCTAAATCCATTCGCATTTTTGACTGATGTGACTGTTGGAGAG
CGTGTTTTTGATGAAGCACCTGTCTTTAATGACGATTCAAATAATCATGATGATGATAAGGATAAAGTAG
CCCAGACCATTATGGTTCTAAACCAGTTAAAAATAATGGCATCTGAAAAAGGAAATATTGACGATTTTCA
ACAATCGGTCATGCTGCAACTGATTAGTGAAGAATATAACGAATCACGTAAAGTTGGACGTACAGGCTCT
ATTACTGGATTTGCGCGACGCTGTTCTAACCATGAAGATAAGCGTATTAAAGATATCGGTGACCAGTTGG
GGCAATGGTGTGAAGGAGGGATTTATGGGAATCGCTTTACAGAAAATCTCCCGCCAATAAATTTTGATAG
CCGGTTTATTGTTCTGGAACTTGAAGAATTGAAGGGGACCCCACACCTTCAGACTGTCGTTCTGATGTCG
ATTATTCAGGCCGCTCAGCATGCAATGTTTATCAAGAAAGACGGACGCCGCCGGTTGTTCATACTTGATG
AGGCATGGGAGTATATCCGTCCGGACAATGCTTCAGGTTCCAGTAATCATTCAAATCAATTTTTCTCCTC
TTTCCTTGAGGCCGCTTGGCGCCGATTCAGGAAAACGAACTGTGCCGGTATTTGTATTACTCAATCCTTT
GAAGATTACTTCACCTCATCGGTTGGTCGCGCACTAACGGCTAACTCGCCGTGGAAGATCATCATGAAGC
AGGAAAAGGAAAGTATTGAAGCCATGAAGGTGAACAACTACTTCTCCACAACTGATGCGGAATATGAGCG
TATGAAAAATATTCGAACGGTAAAGCGTGCATTTTCCGAGATGCTCGTACGATTCGAAAATTTCCAGGAG
ATATGTCGCCTCTATGTAGATAGAAAAATGGAGCTTTGCTTTACGACTGACAGCACCGATCGTGGAAAAC
TATGGGAAATCCAAAGCCGACTTGATTGCTCTTACGGCGAAGCAATTGAGATTCTGTACGAACAGGAAGT
TGCGAGCAAATCAGCTGCCTGA
 Primer design