SecReT4
Protein ID: 160872939
T4SS name [ID]Tra_F [538]
Gene symbol-
Locus tagSbal195_4529
StrainShewanella baltica OS195
Repliconplasmid pS19501 [GenBank: NC_009998] [Browse all T4SS(s) in this replicon]
Location [Strand]5401..6276 [-]
Producttype-F conjugative transfer system pilin assembly protein TraF
Component typeTraF_F
UniProt IDA9L6A4
KEGG IDsbn:Sbal195_4529
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.2e-69, Aligned region: 63..281
Protein Sequence: 291 a.a.     [Download]
>gi|160872939|ref|YP_001556946.1| type-F conjugative transfer system pilin assembly protein TraF [Shewanella baltica OS195]
MRTLLNNRLQHAAASPFFRWSSRAPLAWLSTKNGDAVVNKRSALVLLMLTTFCHGANATDAQGWRWYNEP
TAPKKQAPKKAETPSVTLTRTKTLTPTEQMDWFHSYYQDTLNDAAINSQDSEKVEKAMLLNQYVSNKSSE
FGMTFKKVLLDNPELSYTKDRPTEQAARSTYLSLERNKKMRAVRSLADAGWGLFFVYKGQEEIDIALAPS
VQQFATEHGIELLGVTLDGVALPAIVQNRQNDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRF
LNVATDFAPDF
 
Nucleotide Sequence: 876 bp     [Download]
>gi|160872934|ref|NC_009998.1|:c6276-5401 Shewanella baltica OS195 plasmid pS19501, complete sequence
ATGAGGACGTTGTTAAATAACCGCTTACAACATGCCGCAGCATCTCCTTTTTTTCGGTGGTCAAGCCGCG
CGCCGTTGGCGTGGTTGTCCACAAAAAATGGGGATGCAGTGGTCAACAAGCGCAGCGCGTTAGTGCTCCT
TATGCTGACAACGTTTTGCCACGGTGCAAACGCCACGGATGCACAAGGGTGGCGCTGGTATAACGAACCG
ACAGCCCCCAAGAAGCAAGCGCCTAAAAAGGCCGAAACGCCAAGCGTCACACTCACGCGCACCAAAACGC
TGACGCCCACCGAGCAGATGGATTGGTTCCACAGCTACTACCAAGACACGCTCAATGACGCGGCGATAAA
CAGCCAAGACAGCGAGAAAGTGGAAAAGGCCATGCTGCTTAATCAGTACGTCAGTAATAAATCGTCAGAG
TTTGGCATGACCTTCAAAAAGGTCCTGCTGGATAACCCTGAGCTGTCTTACACCAAAGACAGGCCAACAG
AGCAAGCGGCAAGAAGCACCTATTTATCATTAGAGCGCAACAAGAAGATGCGCGCGGTACGCAGCCTTGC
CGATGCGGGATGGGGGCTGTTCTTTGTCTACAAAGGCCAAGAAGAAATTGATATTGCGCTAGCGCCCAGC
GTGCAGCAGTTCGCTACAGAGCATGGCATTGAGCTACTTGGCGTCACGCTCGATGGTGTCGCACTGCCAG
CCATCGTGCAGAACCGTCAAAACGACCAGCACATAAACGTCCCGTTTAGTCCCGCACTCGTGTTAGTTAA
TCCTGGCACGGGGGAAATGAAACCGCTCGCTTATGGCTTTATCTCTCAAGACGATTTACTTGGCCGCTTC
CTGAACGTGGCCACCGATTTCGCCCCTGACTTTTAA
 Primer design