SecReT4
Protein ID: 160872950
T4SS name [ID]Tra_F [538]
Gene symbol-
Locus tagSbal195_4540
StrainShewanella baltica OS195
Repliconplasmid pS19501 [GenBank: NC_009998] [Browse all T4SS(s) in this replicon]
Location [Strand]16940..17242 [-]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDA9L6B5
KEGG IDsbn:Sbal195_4540
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.4e-33, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|160872950|ref|YP_001556957.1| type IV conjugative transfer system protein TraL [Shewanella baltica OS195]
MDNPTQFFSIPKHLNNTPTLLGFAMDELVPALVFFAVLFMMNHALIGMVLASSWFLGMRRMKSQYGMSVL
RLTAYWYAPAEFSASFLKRTPAACRRYWLR
 
Nucleotide Sequence: 303 bp     [Download]
>gi|160872934|ref|NC_009998.1|:c17242-16940 Shewanella baltica OS195 plasmid pS19501, complete sequence
GTGGATAACCCCACTCAGTTTTTTAGCATCCCTAAACACCTCAACAACACCCCTACGTTATTAGGGTTTG
CGATGGATGAACTTGTTCCTGCCTTAGTGTTTTTTGCCGTGTTATTCATGATGAATCACGCGCTCATTGG
CATGGTACTAGCCTCTTCATGGTTTTTAGGGATGCGCAGAATGAAATCGCAATACGGCATGAGCGTATTA
CGCCTCACCGCTTATTGGTACGCCCCTGCAGAATTTAGCGCTTCATTTTTAAAACGAACACCTGCGGCAT
GTCGCCGCTACTGGTTACGTTAA
 Primer design