SecReT4
Protein ID: 160873031
T4SS name [ID]Tra_F [537]
Gene symbol-
Locus tagSbal195_4621
StrainShewanella baltica OS195
Repliconplasmid pS19502 [GenBank: NC_009999] [Browse all T4SS(s) in this replicon]
Location [Strand]33312..34187 [-]
Producttype-F conjugative transfer system pilin assembly protein TraF
Component typeTraF_F
UniProt IDA9L6J5
KEGG IDsbn:Sbal195_4621
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.2e-69, Aligned region: 63..281
Protein Sequence: 291 a.a.     [Download]
>gi|160873031|ref|YP_001557037.1| type-F conjugative transfer system pilin assembly protein TraF [Shewanella baltica OS195]
MMTLLNNRLQHAAAVPFFRWSSRAPLAWLSTKKGDAVVNKRSALVLLMLTTFCLGANATDAQGWRWYNEP
TAPKKQAPKKAETPSVTLTRTQTLTPTEQMDWFHSYYQDTLNDAAINSQDSEKVERAMLLNQYVSNKSSE
FGMTFKKVLLDNPELSYTKDRPTEQAARSTYLSLERNKKMRAVRTLADAGWGLFFVYKGSEEIDIALAPS
VQQFATQHGIELLGVTLDGVALPAIVQNRQNDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRF
LNVATDFAPDF
 
Nucleotide Sequence: 876 bp     [Download]
>gi|160873002|ref|NC_009999.1|:c34187-33312 Shewanella baltica OS195 plasmid pS19502, complete sequence
ATGATGACGTTGTTAAATAACCGCTTACAACATGCCGCCGCAGTGCCTTTTTTTCGGTGGTCAAGCCGCG
CGCCGTTGGCGTGGTTGTCCACAAAAAAAGGGGATGCGGTGGTCAACAAGCGCAGCGCGTTAGTGCTCCT
TATGCTGACAACGTTTTGCCTCGGCGCAAACGCCACGGATGCACAAGGCTGGCGCTGGTATAACGAACCG
ACTGCCCCCAAGAAGCAAGCGCCTAAAAAGGCCGAAACGCCAAGCGTCACACTCACGCGCACCCAAACCC
TGACGCCCACCGAGCAGATGGATTGGTTTCACAGCTACTACCAAGACACGCTCAATGACGCGGCGATAAA
CAGCCAAGACAGCGAGAAAGTGGAAAGGGCCATGCTGCTTAATCAGTACGTCAGCAATAAATCCTCAGAG
TTTGGCATGACCTTCAAAAAGGTCCTGCTGGATAACCCTGAGCTGTCTTACACCAAAGACAGACCGACGG
AACAAGCGGCTAGAAGTACGTATTTATCATTAGAGCGCAACAAGAAGATGCGCGCAGTACGCACCCTTGC
CGATGCGGGATGGGGCCTGTTCTTTGTCTACAAAGGCAGTGAAGAAATTGATATTGCGCTGGCGCCCAGC
GTGCAGCAGTTCGCAACGCAACATGGCATTGAGCTACTGGGCGTCACGCTCGATGGTGTAGCACTGCCAG
CCATCGTGCAGAACCGCCAAAACGACCAGCACATAAACGTCCCGTTTAGTCCCGCACTCGTGTTAGTTAA
TCCTGGCACGGGGGAAATGAAACCGCTCGCTTATGGCTTTATCTCTCAAGACGATTTACTTGGCCGCTTC
CTGAACGTGGCCACCGATTTCGCCCCTGACTTTTAA
 Primer design