SecReT4
Protein ID: 160873042
T4SS name [ID]Tra_F [537]
Gene symbol-
Locus tagSbal195_4632
StrainShewanella baltica OS195
Repliconplasmid pS19502 [GenBank: NC_009999] [Browse all T4SS(s) in this replicon]
Location [Strand]44848..45150 [-]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDA9L6K6
KEGG IDsbn:Sbal195_4632
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.2e-33, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|160873042|ref|YP_001557048.1| type IV conjugative transfer system protein TraL [Shewanella baltica OS195]
MDNPTQFFSIPKHLNNTPTLLGFAMDELVPALVFFAVLFMMDHALIGMALASSWFLGMRRMKSQYGMCVL
RLTAYWYAPAEFSASFLKRTPAACRRYWLR
 
Nucleotide Sequence: 303 bp     [Download]
>gi|160873002|ref|NC_009999.1|:c45150-44848 Shewanella baltica OS195 plasmid pS19502, complete sequence
GTGGATAATCCCACTCAGTTTTTCAGCATCCCTAAACACCTCAATAACACACCTACGCTATTAGGGTTTG
CGATGGATGAACTTGTTCCTGCCTTAGTGTTTTTTGCCGTGTTATTCATGATGGATCACGCGCTCATTGG
CATGGCGCTAGCCTCTTCATGGTTTTTAGGGATGCGCAGAATGAAATCGCAATACGGCATGTGCGTGTTA
CGCCTCACTGCCTATTGGTATGCCCCTGCAGAATTTAGCGCATCATTTTTAAAACGAACGCCTGCGGCCT
GTCGCCGCTACTGGTTACGTTAA
 Primer design