SecReT4
Protein ID: 160873100
T4SS name [ID]Trb [306]
Gene symbol-
Locus tagSbal195_4691
StrainShewanella baltica OS195
Repliconplasmid pS19503 [GenBank: NC_010000] [Browse all T4SS(s) in this replicon]
Location [Strand]22549..22869 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA9L6R3
KEGG IDsbn:Sbal195_4691
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.5e-14, Aligned region: 6..96
Protein Sequence: 106 a.a.     [Download]
>gi|160873100|ref|YP_001557105.1| conjugal transfer protein TrbC [Shewanella baltica OS195]
MQKVPFAFFTIFTLMMIFIPDLAHASSSTGMPWENPLLKVVNSITGPLAFGISVVAVCCATWPLAFGGEL
TTFAKTALYIALAISFSVFAVNILSSLFGISSTLVK
 
Nucleotide Sequence: 321 bp     [Download]
>gi|160873076|ref|NC_010000.1|:22549-22869 Shewanella baltica OS195 plasmid pS19503, complete sequence
ATGCAAAAGGTTCCCTTTGCTTTTTTCACCATATTCACTCTGATGATGATCTTCATCCCAGACCTCGCCC
ACGCATCCAGTAGTACCGGCATGCCATGGGAAAATCCGTTATTAAAAGTGGTTAACTCCATTACAGGGCC
GCTAGCATTCGGGATATCCGTTGTTGCCGTTTGCTGCGCGACTTGGCCGCTCGCATTTGGGGGTGAACTT
ACTACGTTTGCTAAAACCGCACTTTATATTGCACTCGCTATCTCATTCTCAGTATTTGCAGTCAATATTT
TATCTTCCCTGTTTGGTATTTCATCGACGCTCGTTAAATGA
 Primer design