SecReT4
Protein ID: 160873103
T4SS name [ID]Trb [306]
Gene symbol-
Locus tagSbal195_4694
StrainShewanella baltica OS195
Repliconplasmid pS19503 [GenBank: NC_010000] [Browse all T4SS(s) in this replicon]
Location [Strand]26393..27724 [+]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDA9L6R6
KEGG IDsbn:Sbal195_4694
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.8e-25, Aligned region: 58..268
Protein Sequence: 443 a.a.     [Download]
>gi|160873103|ref|YP_001557108.1| P-type conjugative transfer protein TrbL [Shewanella baltica OS195]
MRLFWLILLLLFIVPNAYAAGVPESGAIDILLETFGNAAAKWAPILRETAIRIFWILVTISWTWTFIWMM
FKDSNYPEIIAELTRRVVLIGIFSWFLFDGVWIASSIVEGFQYLALKLGGTPIKPSSIFDIGYSLASSIL
KKLTYTDWADNIGFILAGLGILIIFAFITLEMMLVTIQYYIMLNLGVILMGFLGHEWSREYGINYFRLML
SIGVKFMCMQMIIVLSMEILNSWLQTSDLTWTQILLILPCIIVIWGLVREVPAMAQSLVSGSDTTSGNAM
AGAMQAAATTAALTAGAIALAAGGGGLLKNAWSQAGGDGGDSGGDGGGGNDPATSPLAENNDGGGGGEAN
ASPLPRSHGNDNADFQGSISGSEQSPSNANPQGNGSEQAAPKSSLASKFVTTAKIASGALAKEGASSAKK
AFLSSQDTFIGRAASSLAPNKKD
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|160873076|ref|NC_010000.1|:26393-27724 Shewanella baltica OS195 plasmid pS19503, complete sequence
ATGCGGCTTTTTTGGTTGATATTGCTCTTACTCTTCATCGTCCCTAATGCCTACGCCGCCGGTGTCCCAG
AATCTGGGGCTATCGACATACTGCTAGAAACCTTTGGAAATGCCGCCGCAAAATGGGCGCCGATATTACG
CGAAACCGCCATAAGAATATTTTGGATATTAGTCACGATATCTTGGACGTGGACGTTTATCTGGATGATG
TTCAAAGATTCGAACTATCCAGAAATTATCGCGGAGTTAACACGGCGAGTTGTTCTGATTGGAATTTTTA
GTTGGTTCCTATTTGATGGCGTGTGGATAGCATCTTCGATTGTAGAAGGCTTCCAATATCTGGCATTAAA
GCTAGGAGGTACGCCAATAAAACCAAGCTCCATTTTTGATATTGGTTATTCATTAGCATCCAGTATTCTC
AAAAAATTAACCTATACAGATTGGGCGGACAACATTGGATTTATTCTTGCGGGACTAGGGATCTTAATCA
TCTTTGCGTTCATCACGCTCGAAATGATGTTAGTCACGATTCAGTATTACATCATGCTTAATTTGGGGGT
GATTTTGATGGGGTTCCTCGGACACGAATGGAGCCGTGAATACGGAATTAATTATTTCAGATTAATGTTG
TCCATTGGCGTTAAATTTATGTGTATGCAGATGATCATCGTCTTATCAATGGAAATTTTAAACAGTTGGC
TCCAAACCAGCGACCTAACGTGGACCCAAATATTGCTGATTTTACCCTGTATTATCGTTATTTGGGGACT
GGTACGAGAGGTTCCAGCTATGGCCCAGAGTCTGGTGAGCGGTTCTGACACCACATCAGGTAATGCCATG
GCTGGCGCAATGCAAGCAGCCGCAACTACCGCAGCACTCACGGCCGGAGCCATTGCCCTTGCCGCTGGCG
GAGGGGGGCTGCTCAAGAATGCATGGTCACAGGCTGGCGGAGACGGAGGGGACAGCGGAGGTGATGGAGG
CGGAGGCAATGACCCCGCAACGTCACCGTTAGCTGAAAATAATGATGGCGGCGGTGGGGGTGAAGCAAAT
GCCTCGCCACTCCCTCGCTCGCACGGGAATGACAACGCTGATTTTCAGGGTTCGATATCCGGTAGTGAAC
AGTCTCCTTCAAATGCCAACCCTCAAGGCAATGGCAGTGAGCAAGCAGCGCCCAAATCGTCCTTAGCGAG
CAAATTTGTCACAACCGCCAAAATAGCCAGTGGCGCGTTAGCAAAAGAAGGGGCCAGTAGCGCTAAAAAA
GCGTTCTTAAGTTCACAAGACACATTCATCGGTCGTGCTGCAAGTTCATTAGCCCCCAACAAGAAAGATT
AA
 Primer design