SecReT4
Protein ID: 160873105
T4SS name [ID]Trb [306]
Gene symbol-
Locus tagSbal195_4696
StrainShewanella baltica OS195
Repliconplasmid pS19503 [GenBank: NC_010000] [Browse all T4SS(s) in this replicon]
Location [Strand]28477..29355 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA9L6R8
KEGG IDsbn:Sbal195_4696
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2e-47, Aligned region: 61..287
Protein Sequence: 292 a.a.     [Download]
>gi|160873105|ref|YP_001557110.1| P-type conjugative transfer protein TrbG [Shewanella baltica OS195]
MRYPLIITALLFYIPMAAAESFDDDYPVPSLSLKENSALALSDAWIEKSTQPITDGTGRVTYYFGDSLPS
VVCSPIKTCVVELEDGEMIAQSGLQLGDSARWKVSMAVSGMGANKRTNLIIKPTDINLETTMTVATDRRV
YQIKLISDAVKWMPFVAFTYPEQRQMEWEVYKAAMVHEIKQNTLSDGAYIPELDFNYQVNGKASFKPLRV
YNDGVKTYVEMPSQVEQGSLPIILVVNGSQKELVNYRYQNSFAQDDGRKINGRFIIDQVSKELILTMGVG
SDQVSILVKHKG
 
Nucleotide Sequence: 879 bp     [Download]
>gi|160873076|ref|NC_010000.1|:28477-29355 Shewanella baltica OS195 plasmid pS19503, complete sequence
ATGCGATATCCCCTCATTATTACGGCATTACTGTTCTATATCCCAATGGCAGCGGCAGAGTCATTTGACG
ACGATTACCCCGTTCCCTCCTTATCCTTGAAAGAAAATTCAGCGCTGGCGTTATCTGATGCATGGATTGA
AAAATCGACCCAACCTATCACCGATGGGACCGGACGAGTGACGTACTACTTTGGCGATTCATTACCGTCG
GTCGTGTGTTCGCCGATAAAAACCTGTGTCGTTGAATTAGAAGATGGAGAAATGATCGCCCAATCCGGAT
TGCAATTAGGGGATAGTGCGCGTTGGAAGGTGTCAATGGCCGTGTCTGGCATGGGTGCAAATAAGCGTAC
TAATTTAATCATCAAGCCCACCGACATTAATCTTGAAACCACGATGACGGTAGCAACCGATAGACGCGTC
TATCAAATTAAGTTGATTTCAGACGCAGTGAAATGGATGCCCTTTGTTGCGTTCACTTACCCAGAACAGC
GCCAAATGGAGTGGGAAGTCTACAAAGCCGCCATGGTTCACGAGATAAAACAAAACACCCTTTCTGATGG
GGCCTATATTCCAGAACTGGATTTTAATTATCAGGTCAATGGCAAGGCGTCATTTAAACCGTTACGGGTT
TATAACGATGGCGTCAAAACGTATGTCGAAATGCCCTCCCAAGTTGAACAGGGCAGTTTACCCATTATTT
TAGTCGTCAACGGTTCACAAAAAGAACTCGTGAACTATCGATACCAAAACAGTTTTGCTCAAGATGATGG
TCGGAAAATCAACGGTCGATTCATTATCGACCAGGTATCCAAAGAGCTGATCCTAACGATGGGTGTTGGA
AGTGATCAGGTATCCATTTTGGTTAAGCACAAGGGCTAA
 Primer design