SecReT4
Protein ID: 160873123
T4SS name [ID]Trb [306]
Gene symbol-
Locus tagSbal195_4714
StrainShewanella baltica OS195
Repliconplasmid pS19503 [GenBank: NC_010000] [Browse all T4SS(s) in this replicon]
Location [Strand]44621..45109 [+]
Productconjugative transfer signal peptidase TraF
Component typeTraF
UniProt IDA9L6T6
KEGG IDsbn:Sbal195_4714
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 6.4e-34, Aligned region: 17..160
Protein Sequence: 162 a.a.     [Download]
>gi|160873123|ref|YP_001557128.1| conjugative transfer signal peptidase TraF [Shewanella baltica OS195]
MGLMLIATVIMYGVGIRINFSHSYPPGIYLVSKAHVYERNDLVLFCPPNNAAIHTAKARDYIRSGRCDSS
TVPMIKRIVGLAGERVEFTPTILINGVALTDSERLITDSQHRPLTQLPNFMIPENSFFAYSDHAPKTSFD
SRYFGAVPMTNIIGHIAPLYIF
 
Nucleotide Sequence: 489 bp     [Download]
>gi|160873076|ref|NC_010000.1|:44621-45109 Shewanella baltica OS195 plasmid pS19503, complete sequence
GTGGGCTTAATGCTGATCGCTACCGTCATTATGTATGGTGTGGGGATCAGAATTAATTTCAGCCACTCAT
ACCCCCCTGGGATTTATCTTGTTTCAAAGGCTCACGTTTACGAGCGTAATGATCTGGTCCTGTTTTGCCC
TCCCAATAATGCCGCTATCCACACAGCAAAAGCGCGTGATTACATCCGCTCTGGTCGCTGTGACAGTAGC
ACAGTTCCCATGATTAAACGGATTGTGGGACTCGCCGGCGAGCGTGTGGAGTTTACCCCAACCATCTTAA
TCAATGGCGTCGCCCTTACAGACTCTGAGCGCCTTATTACGGATAGTCAGCATCGACCGTTAACACAACT
TCCAAATTTTATGATCCCTGAGAACAGCTTTTTTGCTTATTCAGACCATGCCCCAAAAACCTCATTTGAT
AGCCGCTATTTTGGTGCTGTTCCGATGACCAACATCATTGGCCATATCGCCCCTCTCTATATATTTTAA
 Primer design