SecReT4
Protein ID: 160895878
T4SS name [ID]Trb [344]
Gene symbol-
Locus tagDaci_0429
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]460047..461321 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA9BPV6
KEGG IDdac:Daci_0429
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 7.9e-58, Aligned region: 228..410
Protein Sequence: 424 a.a.     [Download]
>gi|160895878|ref|YP_001561460.1| conjugation TrbI family protein [Delftia acidovorans SPH-1]
MSQDDTPDLTTPQAGKVAPEAVALRAQPCPVTRLNRRTLAVLVGGLSVAVLGATIWSLQPHRRGTGEQTE
LYNVDRVSKSEGLDGLPSDYSKLRKVPELGPPLPGDLGPAIVASQQPAVAAYAAPGHDPNDALRKEAEAA
AASSVFFRSGGQGQGQAATVAQAAPGAPGAASALAAFDPLAAGPASTAAQPADPTATQNRQDQKEAFLKG
GSTETRNSGNLALPASPYQVMAGTVIAGALVTGIKSDLPGDVIATVTEPVYDTATGKFLLIPQGSRILGR
YNSQVSYGQSRVQVVWNRVILPDTSSLTLDNLVGTDPAGYAGLEDDVDWHWNRVFAGAVLTTLLGVGAEL
AAPENRQDGNRIVIAGRDSAQDSINQVGQEITRRNMNIQPTLTARPGLPVRVIVARDLVLRPYQPMFYQL
GGAR
 
Nucleotide Sequence: 1275 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c461321-460047 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAGCCAGGACGACACCCCCGACCTCACCACGCCGCAGGCGGGCAAGGTCGCGCCCGAGGCGGTGGCGC
TACGCGCCCAGCCGTGTCCGGTCACGCGCCTGAACCGGCGCACGCTGGCCGTCCTCGTCGGCGGCCTGTC
GGTCGCCGTGCTCGGGGCCACGATCTGGTCATTGCAGCCGCATCGGCGCGGCACTGGCGAACAGACCGAG
CTTTACAACGTGGATCGCGTATCGAAGTCCGAGGGGCTGGATGGCCTGCCTTCCGACTACTCGAAGCTGC
GGAAGGTGCCCGAGTTGGGGCCGCCGCTGCCGGGCGATCTTGGCCCCGCCATCGTCGCTTCGCAGCAGCC
GGCCGTAGCCGCTTACGCGGCCCCCGGCCACGATCCGAATGACGCTTTGCGCAAAGAGGCGGAAGCCGCT
GCGGCTTCGTCGGTGTTCTTCCGCTCCGGCGGCCAGGGCCAAGGCCAGGCCGCAACGGTGGCGCAGGCGG
CGCCGGGTGCGCCGGGTGCTGCAAGCGCGCTCGCAGCCTTCGACCCGCTCGCCGCCGGGCCGGCCTCGAC
GGCGGCCCAGCCCGCCGACCCGACCGCCACGCAGAACCGGCAAGACCAGAAGGAGGCGTTCCTGAAAGGC
GGCTCTACGGAAACCCGCAATTCCGGCAACCTGGCGCTGCCGGCGTCGCCGTATCAGGTGATGGCCGGTA
CGGTGATCGCCGGGGCGCTGGTCACAGGCATCAAGTCCGATCTTCCGGGCGATGTGATCGCCACCGTCAC
GGAGCCCGTCTATGACACGGCCACGGGCAAGTTCCTGCTGATCCCGCAGGGATCGCGCATCCTCGGGCGC
TACAACAGCCAGGTCAGCTACGGGCAGAGCCGCGTACAGGTGGTATGGAACCGGGTCATCCTGCCCGACA
CGTCATCGCTGACGCTCGACAACCTCGTGGGCACCGACCCGGCCGGCTACGCCGGCCTGGAAGACGACGT
GGACTGGCACTGGAACCGCGTCTTCGCCGGCGCCGTGTTGACGACGCTGCTGGGCGTGGGCGCCGAGCTG
GCCGCGCCGGAGAACCGCCAGGACGGCAACCGCATCGTCATCGCCGGGCGCGACAGCGCACAGGACAGCA
TCAATCAGGTCGGCCAGGAGATCACTCGGCGCAACATGAACATCCAGCCGACGCTGACAGCACGACCGGG
CTTGCCGGTTCGGGTGATCGTGGCGCGCGACCTCGTGTTGCGTCCTTACCAACCCATGTTCTATCAGCTT
GGAGGTGCGCGATGA
 Primer design