SecReT4
Protein ID: 160895879
T4SS name [ID]Trb [344]
Gene symbol-
Locus tagDaci_0430
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]461324..462313 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA9BPV7
KEGG IDdac:Daci_0430
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3e-67, Aligned region: 103..322
Protein Sequence: 329 a.a.     [Download]
>gi|160895879|ref|YP_001561461.1| P-type conjugative transfer protein TrbG [Delftia acidovorans SPH-1]
MNPSFRTYVSVLALAALAGCATQGKPPPTISLDEPVQAQPLPEPPAPVEAVAVPEVLPMPAQLKPAPEGE
EAKPAPEPVDEKVRVSRANTEARVAPTREGYVNAIQVWPFTDGALYQVYAAVGRVTVIALQPGEELVTVA
AGDTVRWIVGDTSSGSGDALRVNVMVKPIRSGLKTNLVVTTSRRTYLLELTSTEKTWMASISWEYPKDKM
LALQRQAQAASAAAPVETGLSLEKIRFRYAISGSNPPWKPLRAFDDGEKVYIQFPAGIAQGELPPLFVIG
AQGDGQLVNYRFRSPYFIVDRLFGAAELRLGGDKGDVVRIERTDGTRGN
 
Nucleotide Sequence: 990 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c462313-461324 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAACCCGTCTTTCCGTACTTACGTTTCCGTGCTGGCGCTCGCGGCCCTGGCGGGCTGCGCCACCCAGG
GCAAGCCGCCGCCGACCATCTCGCTCGATGAGCCGGTGCAGGCGCAGCCGCTGCCGGAGCCGCCTGCACC
TGTGGAGGCGGTCGCTGTGCCCGAGGTGCTGCCGATGCCGGCACAGTTGAAGCCAGCGCCCGAGGGCGAA
GAAGCCAAGCCGGCGCCGGAGCCGGTCGACGAGAAGGTGCGCGTCTCACGGGCCAATACCGAGGCGCGCG
TCGCGCCCACGCGCGAGGGCTACGTCAACGCGATTCAGGTGTGGCCTTTCACGGACGGCGCGCTGTATCA
GGTCTATGCGGCCGTGGGCCGCGTGACCGTGATCGCGCTCCAGCCCGGTGAGGAACTGGTGACGGTGGCC
GCTGGCGACACGGTGCGCTGGATCGTGGGCGACACATCGAGCGGCAGCGGGGATGCGCTGCGCGTGAACG
TGATGGTCAAGCCCATCCGCTCGGGCCTCAAGACGAATCTCGTTGTAACCACCAGCCGACGCACCTATCT
GCTGGAACTGACCTCGACAGAGAAGACATGGATGGCGTCGATATCCTGGGAGTACCCCAAGGACAAGATG
CTCGCCTTGCAGCGCCAGGCGCAGGCGGCCAGCGCCGCCGCGCCGGTCGAGACCGGGCTGTCGCTGGAGA
AGATCCGTTTCCGCTATGCCATCAGTGGCAGCAATCCGCCGTGGAAGCCGCTGCGCGCCTTCGATGACGG
CGAGAAGGTATATATCCAGTTTCCCGCCGGCATCGCCCAGGGCGAGTTGCCGCCGCTGTTCGTGATCGGT
GCGCAGGGCGACGGGCAATTGGTGAACTACCGCTTCCGCTCGCCGTATTTCATCGTTGATCGCTTGTTCG
GCGCTGCCGAGTTGCGCTTGGGCGGGGACAAGGGCGACGTGGTGCGGATCGAGCGCACCGACGGCACGCG
GGGGAACTGA
 Primer design