SecReT4
Protein ID: 160895880
T4SS name [ID]Trb [344]
Gene symbol-
Locus tagDaci_0431
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]462310..463014 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA9BPV8
KEGG IDdac:Daci_0431
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.6e-61, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|160895880|ref|YP_001561462.1| conjugal transfer protein TrbF [Delftia acidovorans SPH-1]
MRFKRPQVRYADTPQPATPYQSAAQVWDERIGSARVQAKNWRFMAFGCLTLAVLMAGGLVWRSAQSIVTP
YVIEVDNAGQVRAVGEAATPYRPSDAQIAYHLGRFIGLVRSLSIDPIVVRQNWLDAYDYTTDKGAVVLNE
YARVNDPFARIGKESVTVQITSVTRASDASFNVRWTEQRFVNGAPAGTERWNAVISIVQQTPRTEQRLRK
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c463014-462310 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCGATTCAAACGACCGCAGGTGCGCTATGCCGACACGCCGCAGCCTGCTACTCCGTACCAATCCGCCG
CACAGGTGTGGGACGAGCGCATCGGCTCGGCCCGCGTGCAGGCGAAGAACTGGCGTTTCATGGCCTTCGG
CTGTCTCACGCTGGCCGTGCTGATGGCCGGGGGCCTGGTCTGGCGCTCGGCGCAATCCATCGTGACACCC
TATGTCATCGAGGTGGACAACGCGGGCCAAGTGCGCGCCGTGGGCGAGGCCGCTACGCCGTACCGGCCCA
GCGATGCGCAGATCGCCTACCACCTGGGCCGCTTCATCGGCCTGGTGCGCTCGCTGTCCATCGACCCGAT
CGTGGTGCGGCAGAACTGGCTGGACGCCTACGACTACACCACCGACAAGGGCGCCGTGGTGCTCAACGAG
TACGCCCGCGTGAACGATCCGTTCGCGCGCATCGGCAAGGAGTCGGTGACGGTGCAGATCACCAGCGTGA
CCCGCGCCAGCGACGCCTCTTTCAACGTGCGCTGGACGGAACAACGCTTCGTCAACGGCGCTCCTGCTGG
CACCGAACGCTGGAACGCGGTGATTTCCATCGTGCAGCAGACCCCGCGCACCGAACAGCGCCTGCGCAAG
AACCCGTTGGGCATCTACGTCAACGGCCTGTCGTGGAGCCGCGAACTGGATTCTTCCGAAGGAGCCAAGC
CATGA
 Primer design