SecReT4
Protein ID: 160895881
T4SS name [ID]Trb [344]
Gene symbol-
Locus tagDaci_0432
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]463033..464406 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA9BPV9
KEGG IDdac:Daci_0432
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 8.6e-48, Aligned region: 37..264
Protein Sequence: 457 a.a.     [Download]
>gi|160895881|ref|YP_001561463.1| conjugal transfer protein TrbL [Delftia acidovorans SPH-1]
MNDVTIIDRFLDTFSRYIDSGFGLLHGEVAFLTATLIVIDMTIAGLFWAMGHAVGQGEDVIAKLIRKVLY
VGAFAYIIGNFNTLAGILFRSFAGLGLTASGSTLSMENFLHPGRLAKVGIDAGAPILEQIGNMAGFPEVF
VNITPIVVMFLAWLIVILCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQVHPAEPSIDHSVVVMLASLTLLALGIFGPGIATGLVSGGPQLGAGAMAGAA
LGAAGAAVAVGAAATGVGGAVAAGARMAPAAAKLAGSGARAAAGAASSARSAFQAGSASAGGGLKGAAAG
FGNVAKTGAQAAGQKVADGARSMKERAAAAFRQEGTTSAGGGTAAASGGPASGGDTPSTAPQEQPAWAKR
LHRRQQLTHAATTAAHTLRGGDGGSSSQGPSLRDSDS
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c464406-463033 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAACGACGTAACGATCATCGACCGCTTCCTCGATACCTTCTCGCGCTACATCGACTCGGGCTTTGGAC
TGCTGCATGGCGAGGTGGCGTTTCTGACCGCCACGCTGATCGTCATCGACATGACGATCGCCGGGCTGTT
CTGGGCGATGGGCCATGCCGTCGGCCAGGGCGAGGACGTGATCGCCAAGCTGATCCGCAAGGTGCTGTAC
GTCGGTGCCTTCGCCTACATCATCGGCAACTTCAACACGCTGGCCGGCATCCTGTTCCGCTCCTTCGCCG
GGCTGGGCCTAACGGCCAGCGGCTCGACCTTGAGCATGGAGAACTTCCTACACCCTGGGCGGCTGGCCAA
GGTCGGCATCGACGCCGGTGCGCCGATCCTTGAGCAGATCGGCAACATGGCGGGCTTCCCCGAGGTGTTC
GTGAACATCACGCCCATCGTCGTGATGTTCCTCGCGTGGTTGATCGTCATCCTGTGCTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCCGGCTTCGTGCTGGTGCCGTT
CGCGCTGTGGAACAAGACCGCGTTCCTCGCCGAAAAGGTGCTGGGCAACGTGGTGTCGTCCGGCATCAAG
GTGCTGGTGCTCGCCGTCATTGTGGGCATCGGCTCGGGGCTGTTCGCCGAGTTTCAGGTACATCCCGCCG
AGCCATCCATCGACCACTCCGTGGTCGTGATGCTGGCCTCGCTGACCCTGCTGGCCTTGGGCATCTTCGG
GCCAGGCATTGCAACCGGGCTGGTGTCTGGCGGGCCGCAGCTTGGCGCGGGTGCGATGGCCGGTGCTGCG
CTGGGCGCTGCGGGCGCTGCCGTTGCCGTCGGCGCCGCAGCCACGGGCGTCGGCGGCGCGGTAGCTGCTG
GAGCGCGCATGGCGCCCGCTGCCGCCAAGCTGGCCGGCAGCGGCGCGCGGGCTGCCGCTGGGGCTGCCAG
CAGTGCACGGTCGGCGTTCCAGGCCGGTTCCGCTTCGGCCGGCGGCGGCCTCAAGGGTGCCGCTGCGGGC
TTCGGCAATGTCGCCAAGACAGGCGCTCAGGCAGCCGGGCAGAAGGTGGCCGATGGCGCGCGTTCGATGA
AGGAACGTGCCGCCGCAGCTTTCCGCCAGGAAGGCACGACTTCGGCGGGAGGCGGTACAGCCGCCGCATC
GGGCGGCCCAGCGTCTGGTGGTGATACGCCCTCCACCGCGCCGCAGGAGCAACCCGCCTGGGCCAAACGC
CTGCATCGCCGCCAGCAACTCACCCATGCCGCAACCACCGCCGCCCACACGCTGCGCGGGGGCGACGGCG
GCAGTTCCAGCCAGGGGCCGAGTCTGCGCGATTCCGATTCCTGA
 Primer design