SecReT4
Protein ID: 160895883
T4SS name [ID]Trb [344]
Gene symbol-
Locus tagDaci_0434
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]464715..465440 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA9BPW1
KEGG IDdac:Daci_0434
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 1.4e-11, Aligned region: 2..37
Protein Sequence: 241 a.a.     [Download]
>gi|160895883|ref|YP_001561465.1| conjugal transfer protein TrbJ [Delftia acidovorans SPH-1]
MKKRLVAAAIAAMLCTATAHAQWVVVDPTNLVQNTLTAIRTLEQINNQIQQLQNEAQMLMNQARNLASLP
SSVVGQLRANLATTQRLIDQARGLAYDVTNLDREFQRLYPEQYAATVSGDQMYRDTQERWKNTLNGLQTT
MRMQAQVSQNLGEDESVLADLVGKSQSAEGALQAMQAMNQLLALQAKQSIQSQRLQITQDRAAALELARQ
AAATERGREMTRRFLGSGTPYTPQAVDFYNH
 
Nucleotide Sequence: 726 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c465440-464715 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAAAAAGCGTCTTGTCGCCGCCGCAATCGCGGCCATGCTTTGCACCGCCACCGCCCATGCGCAATGGG
TCGTGGTCGATCCCACCAACCTCGTGCAGAACACGCTGACCGCGATCCGCACGCTGGAGCAGATCAACAA
CCAGATCCAGCAGCTTCAGAACGAAGCGCAGATGCTGATGAACCAGGCGCGCAATCTCGCCAGCCTGCCA
TCCAGCGTGGTCGGCCAGTTGCGCGCCAATCTGGCGACCACGCAGCGGCTGATCGACCAGGCGCGCGGCC
TGGCCTACGACGTGACGAATCTGGATCGGGAGTTTCAGCGCCTGTATCCCGAGCAGTACGCCGCCACGGT
GAGCGGCGACCAGATGTACCGCGACACGCAGGAGCGATGGAAGAACACGCTCAACGGCTTGCAGACCACG
ATGCGGATGCAGGCCCAGGTTTCGCAGAACCTGGGCGAAGACGAAAGCGTGCTCGCCGACCTCGTGGGCA
AGAGCCAGTCAGCCGAAGGTGCGTTGCAGGCGATGCAGGCCATGAACCAGTTGCTGGCCTTGCAGGCCAA
GCAGTCGATCCAGTCGCAGCGGCTCCAGATCACGCAGGATCGCGCTGCCGCGCTGGAACTGGCGCGGCAG
GCGGCGGCCACGGAGCGCGGACGTGAGATGACGCGCCGCTTCCTGGGCAGTGGCACGCCGTACACGCCGC
AAGCCGTCGATTTCTACAACCACTGA
 Primer design