SecReT4
Protein ID: 160895884
T4SS name [ID]Trb [344]
Gene symbol-
Locus tagDaci_0435
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]465437..467890 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA9BPW2
KEGG IDdac:Daci_0435
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.8e-39, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 1.4e-16, Aligned region: 298..388
DUF853 [PF05872], Evalue: 2.4e-07, Aligned region: 613..684
Protein Sequence: 817 a.a.     [Download]
>gi|160895884|ref|YP_001561466.1| conjugal transfer ATPase TrbE [Delftia acidovorans SPH-1]
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRMG
SGWALFIEAERRPAADYPHSEFPEPLSWVVEEERRAAFEESGHHFESGYHLTLLYLPPEESRARAAKMLY
ENTPTNGVDWRERLQAFVAETDRVFDLLDGVMPEIVWLDDSQTLTYLHTTISTRRYRVGVPEVPFHIDAL
LTDSPLVGGLAPMLGDQHLRVVSVRGFPTSTWPGILDDLNRLGFAYRWSTRFLCLDKSEAEKELTRLRRQ
WFAKRKNVIALLRETIFQQESPLVDTDASNKATDADAALQELGSDQVAFGYLTATVTVLDADPAVADEKL
RMVERVIQGRGFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPVSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRIFAFDMGRSMRATILGLG
GEHYDLGTDGEIAFQPLARIDREGYRTWAAEWVEGRLLHEGVAVGPDEKAAIWSALGSLAGAPVEQRTMT
GLSVLLQSNALRQALAPYVLGGAHGKLLDADHDRLGMADVQCFEMEELMHSKAAVMAVLHYLFARFDERF
DGSPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPN
PQATEPQIRTIYEGFGLNSRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAALAFAGASTPQDQRDIDR
VLLDAGVPGFAGAWLRHRGLDWAADLLPSFPGLAPGSLADQPLENLS
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c467890-465437 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCTGAACCTCGCCGAATACCGCCAGCGCCCGGCCTTGCTTGCCGACTGGCTGCCCTGGGCCGGGCTGG
TCGCACCGGGCGTCGTCTTGAACAAGGACGGCAGTTTCCAGCGCACGGCCCGGTTTCGCGGGCCTGACCT
CGACAGCGCGACGCAAGGCGAGCTGATCGCCACGTCGGCGCGGTTGAACAACGCGCTGCGCCGCATGGGA
TCGGGCTGGGCGCTGTTCATCGAAGCCGAGCGCCGGCCTGCGGCCGACTATCCGCACTCGGAGTTTCCCG
AGCCGCTTTCGTGGGTGGTGGAGGAAGAACGCCGGGCCGCCTTCGAGGAATCGGGCCATCACTTCGAGAG
CGGCTATCACCTGACGTTGCTTTACCTGCCGCCGGAAGAATCCCGCGCCCGTGCAGCCAAGATGCTCTAC
GAGAACACACCGACGAATGGCGTGGACTGGCGCGAGCGGCTGCAAGCCTTCGTCGCGGAAACGGATCGCG
TCTTTGACCTGCTCGACGGCGTGATGCCGGAAATCGTCTGGCTGGATGACAGCCAGACGCTGACCTACCT
GCACACGACCATCTCGACGCGGCGCTACCGCGTCGGTGTGCCCGAAGTGCCGTTCCACATCGACGCCCTG
CTGACCGACTCGCCGCTGGTCGGTGGCCTGGCGCCCATGCTGGGCGACCAGCACCTGCGCGTGGTGTCGG
TGCGCGGTTTTCCGACCTCGACCTGGCCGGGGATTCTGGACGACCTCAACCGCTTGGGCTTTGCATATCG
TTGGAGTACGCGCTTTCTCTGTCTCGACAAATCCGAGGCGGAAAAGGAACTCACCCGCCTGCGCCGCCAG
TGGTTTGCAAAAAGGAAGAACGTCATCGCGCTGCTGCGCGAAACGATCTTCCAGCAGGAAAGCCCGTTGG
TCGATACTGACGCCAGCAACAAGGCGACCGACGCCGATGCCGCCTTACAGGAGCTGGGCAGCGATCAGGT
CGCCTTCGGCTATCTCACCGCCACGGTGACGGTGCTCGATGCCGACCCGGCCGTAGCCGACGAGAAGCTG
CGCATGGTGGAGCGGGTCATCCAGGGGCGCGGCTTCGTCACCATCCCGGAAACGCTCAACGCCGTGGATG
CGTGGCTGTCATCCATTCCGGGCAACGCTTACGCCAACGTGCGCCAGCCCATCGTCTCGACGCTGAACCT
AGCACACATGATGCCGGTGTCCGCAGTATGGGCGGGGCCGGAAAAGAACGACCACCTCGACGGCCCGCCG
CTGATCGTCACGCGCACCGATGGCGCGACGCCGTTCCGGCTGGTGACGCACATCGGCGACGTGGGCCACA
CGCTGGTCGCAGGCCCGACCGGCATGGGCAAGTCGGTCTTGCTCGCCACGCTGGCGATGCAGTTCCGTCG
CTATCGCGGTTCGCGCATCTTCGCCTTCGACATGGGCCGCTCGATGCGGGCCACGATCCTGGGCTTGGGC
GGCGAACACTACGACCTGGGCACGGATGGCGAAATCGCCTTCCAGCCCTTGGCACGCATCGACCGCGAGG
GCTACCGCACCTGGGCCGCAGAATGGGTCGAAGGCCGCTTGCTGCACGAAGGCGTGGCGGTCGGCCCCGA
CGAGAAGGCGGCTATCTGGTCGGCGCTTGGAAGCCTCGCCGGTGCGCCGGTGGAGCAGCGCACGATGACC
GGCCTGTCGGTGCTGCTGCAATCGAACGCGCTGCGCCAGGCGCTCGCGCCCTACGTGCTCGGTGGTGCGC
ACGGCAAGCTGCTGGACGCTGACCACGACCGGCTCGGCATGGCCGACGTGCAGTGCTTCGAGATGGAGGA
GCTGATGCACAGCAAGGCCGCCGTCATGGCCGTGCTGCATTACCTCTTTGCGCGCTTCGATGAACGCTTC
GACGGATCGCCCACGCTGCTGATCCTCGATGAAGCGTGGTTGTTCCTCGATGACCCGGTGTTTGCCGCGC
GTATCCGCCAGTGGCTCAAGACGCTACGCAAGAAAAACGTGTCGGTGATCTTCGCCACGCAGTCGCTCGC
GGACATCAAGGATTCGAGCATCGCCCCCGCGATTATCGAAAGCTGCGCCAGCCGCATCTTCCTGCCGAAC
CCGCAGGCGACTGAGCCGCAGATTCGCACGATCTACGAAGGCTTCGGCCTCAACAGCCGGCAGATCGAGA
TCGTCGCCACCGCGCAGCCCAAGCGCGACTACTACTACCAATCCCGCCTCGGCAACCGCCTGTTCGACCT
CGACCTGGGGCCGGCCGCGCTGGCGTTTGCGGGCGCTTCCACGCCGCAAGACCAGCGCGACATAGACCGC
GTGCTGCTGGACGCCGGCGTACCCGGCTTCGCGGGCGCCTGGCTGCGCCATCGCGGCCTCGATTGGGCGG
CCGACCTGCTGCCCTCGTTCCCCGGCCTTGCGCCGGGTTCCCTCGCTGATCAACCCCTGGAGAACCTGTC
ATGA
 Primer design