SecReT4
Protein ID: 160895887
T4SS name [ID]Trb [344]
Gene symbol-
Locus tagDaci_0438
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]468555..469616 [-]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDA9BPW5
KEGG IDdac:Daci_0438
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.7e-80, Aligned region: 26..292
FtsK_SpoIIIE [PF01580], Evalue: 1.6e-06, Aligned region: 143..203
TrwB_AAD_bind [PF10412], Evalue: 1.9e-06, Aligned region: 144..185
Protein Sequence: 353 a.a.     [Download]
>gi|160895887|ref|YP_001561469.1| P-type conjugative transfer ATPase TrbB [Delftia acidovorans SPH-1]
MSAAPSSLTTSLDRRIQMLRTAMGPLIAAALEDPDVVEVMLNPDRTLWVDRLSSGRAPMGAELPETDGER
IIRLVAAHVGAEVHRGQPLLSAELPETGERFEGILPPAAPGPAFALRKRAIGVIPLSRYIEDGMMTAEQA
GFLVRAVRERQNVLIAGATSSGKTTLANALLAEIAATGDRVLVLEDTIELQCAARDHVPLRTRAGVVSMT
ELVRSSMRLRPDRVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRALI
AEAVNVVIHIAGRGRKRRIESIARVVGFDGVGYRLADWEADALDTPFPELSPNPDAVPAAATSSSLDSLG
ELP
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c469616-468555 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAGCGCCGCGCCTTCATCCCTCACCACCTCGCTCGACCGCCGCATCCAGATGCTGCGCACGGCGATGG
GGCCGCTGATCGCCGCCGCGCTCGAAGACCCGGACGTGGTGGAGGTGATGCTGAACCCCGATCGCACCCT
TTGGGTGGATCGGCTTTCCAGTGGGCGCGCGCCGATGGGCGCGGAGTTGCCGGAGACGGACGGCGAGCGA
ATCATCCGCTTGGTCGCGGCCCACGTTGGCGCAGAAGTCCATCGCGGGCAACCGCTGCTGTCCGCCGAGT
TGCCCGAAACCGGCGAACGCTTCGAGGGCATCTTGCCGCCCGCTGCGCCGGGGCCGGCCTTCGCGCTGCG
CAAGCGCGCCATCGGCGTCATCCCTCTGTCGCGCTACATCGAGGACGGAATGATGACCGCCGAGCAGGCG
GGCTTTCTCGTTCGCGCCGTGCGCGAGCGCCAGAACGTCCTGATCGCAGGAGCCACGAGCAGCGGCAAGA
CCACGCTCGCCAATGCGCTGCTGGCCGAGATCGCCGCCACGGGCGACCGCGTACTGGTGCTCGAAGACAC
CATCGAGTTGCAATGCGCGGCCCGCGACCATGTGCCGCTGCGCACGCGCGCCGGCGTCGTGTCCATGACC
GAACTGGTGCGGTCGTCCATGCGCCTGCGGCCTGATCGCGTCGTCGTCGGCGAGGTGCGCGGCGCCGAGG
CGCTGGATCTCATCAAGGTGTGGGGCACCGGCCATCCGGGCGGTATCGCCACGATCCACGCCGGCTCCGC
GCTCGGCGCGCTGCTGCGCCTGGAGCAACTGATTCTCGAAGTGGCGGTGAACCCGCCGCGTGCGCTGATC
GCCGAGGCGGTCAACGTGGTGATCCATATCGCCGGGCGCGGGCGCAAGCGCCGCATCGAGAGCATCGCCC
GCGTCGTCGGCTTTGACGGCGTGGGCTACCGATTGGCGGATTGGGAGGCGGACGCGCTGGACACGCCGTT
TCCCGAGTTGTCGCCAAACCCCGATGCCGTACCCGCTGCGGCGACTTCCTCATCCCTTGACTCACTTGGA
GAACTGCCATGA
 Primer design