SecReT4
Protein ID: 160895889
T4SS name [ID]Trb [344]
Gene symbol-
Locus tagDaci_0440
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]470074..472095 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA9BPW7
KEGG IDdac:Daci_0440
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.5e-104, Aligned region: 111..562
TraG-D_C [PF12696], Evalue: 2.9e-31, Aligned region: 408..528
TrwB_AAD_bind [PF10412], Evalue: 1.7e-30, Aligned region: 172..543
Protein Sequence: 673 a.a.     [Download]
>gi|160895889|ref|YP_001561471.1| conjugal transfer coupling protein TraG [Delftia acidovorans SPH-1]
MQGTNVLFGQIAVVFGIVIAGVWSATQWTAAALGYQLRLGSPWFDLLGTPIYHPWKLFEWWFFFDAYAPR
VFDTGGAIAGGSGLLAVVVAIGMSIWRSRQSRLVTTYGSARWANADDIRKAGLTQPAGVFLGQHDRQYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDAKSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
SPFELTLHRMMTTPHLVNEEGGGPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCD
WRIADLIAAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIQRRHKLLLMLDEFPALGR
LDFFETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELR
AQRNYAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVAPIKAKKLRYYADANFKRRVL
PPPALADGQYADAPPLRPDDWSGLAIPSVPAALAAASADGLENLGSADDGGPRRQPELSETVAYDSELAA
PTADLALLDDDDDLPLPLPRQLDPAMQRSARLASLDPNDGIEL
 
Nucleotide Sequence: 2022 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c472095-470074 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCAAGGGACGAACGTGCTGTTCGGTCAGATCGCCGTGGTATTCGGCATCGTGATCGCTGGCGTATGGA
GCGCCACGCAATGGACAGCAGCAGCCCTTGGCTACCAGCTACGCCTTGGCTCGCCCTGGTTCGATCTTCT
CGGCACACCGATCTACCACCCGTGGAAACTGTTCGAGTGGTGGTTCTTCTTCGATGCCTACGCGCCGCGC
GTGTTCGATACCGGCGGCGCCATCGCGGGCGGCAGTGGCCTGCTGGCGGTGGTGGTCGCCATCGGTATGT
CGATCTGGCGCTCGCGCCAATCGCGGCTGGTTACGACCTACGGCTCGGCACGCTGGGCGAACGCGGATGA
CATTCGCAAGGCTGGCCTCACGCAGCCGGCCGGCGTGTTCCTCGGCCAGCACGACCGCCAGTACCTGCGG
CATGAAGGCCCGGAACACGTCCTGACCTTCGCGCCCACGCGCTCGGGCAAAGGTGTGGGCCTGGTGGTGC
CGACGCTGCTTTCCTGGCCAGCCTCGGCCGTCATCCACGACATCAAGGGCGAGAACTGGCAGATCACCGC
CGGTTGGCGCTCGCGCTTCTCGCATTGCCTGCTGTTCAACCCGACCGATGCGAAGTCAGCGGCCTACAAC
CCGCTGCTGGAGGTACGGCGCGGCGCGCATGAGGTGCGCGACGTGCAGAACATCGCGGACATTCTGGTTG
ATCCCGAAGGTGCGCTGGAGAAGCGCAACCATTGGGAAAAGACCTCGCACGCGCTACTGGTTGGGGCCAT
CCTGCATGTGCTCTACGCAGGCGAAGACAAGACTCTGCGCGGCGTCGCCAACTTCCTCTCCGACCCGGCC
AGTCCGTTCGAGCTGACCTTGCATCGGATGATGACTACGCCGCACCTCGTGAACGAGGAAGGTGGTGGCC
CACATCCCGTGGTGGCATCCGCTGCGCGCGAAGTCCTCAACAAGAGCGATAACGAACGCTCGGGCGTGCT
GTCCACGGCCATGTCGTTCCTCGGCCTGTACCGCGATCCCACGGTGGCCGAAGTCACCTCGCGTTGCGAT
TGGCGCATCGCTGACCTGATCGCTGCCGAGCATCCGGTATCGCTGTACCTCGTGGTGCCGCCTTCGGACA
TTTCGCGGACGAAGCCGCTCATTCGCCTGATCCTCAACCAGATCGGCCGGCGCCTCACCGAATCGCTCGA
CGGCTCCGACGGCATTCAGCGCCGCCACAAGCTGCTGCTGATGCTCGATGAGTTCCCGGCGCTGGGGCGG
CTCGACTTCTTCGAGACGGCCCTGGCCTTCATGGCGGGCTACGGCATCCGCAGCTTCCTCATCGCGCAGT
CGCTCAACCAGATCGACAAAGCCTATGGCCAGAACCATTCGATTCTGGACAACTGCCATGTGCGCGTGAC
GTTCGCCACGAACGACGAGCGCACGGCCAAGCGCATTTCCGAAACGCTCGGCACCGCTACCGAGCTGCGC
GCGCAGCGCAACTACGCGGGCCATCGGCTCGCGCCGTGGCTGGGCCACCTGATGGTGTCGCGCCAGGAAA
CCGCGCGCCCGCTGCTGACGCCGGGCGAAGTCATGCAGCTTCCGCCTGACGAGGCCGTGGTGATGGTGTC
CAGCGTGGCGCCGATCAAGGCGAAGAAGCTGCGCTACTACGCGGACGCCAATTTCAAGCGTCGCGTGCTG
CCACCGCCCGCGCTGGCGGATGGGCAGTACGCCGACGCGCCGCCATTGCGGCCCGACGACTGGAGCGGGT
TGGCGATTCCGTCCGTGCCCGCTGCACTGGCCGCCGCGTCCGCTGATGGCCTGGAGAACTTGGGTTCGGC
CGACGACGGCGGCCCGCGCCGTCAGCCCGAACTCTCCGAAACCGTCGCCTACGACTCCGAGCTGGCCGCT
CCCACGGCCGACCTCGCGCTGCTCGATGACGACGACGACCTGCCGCTTCCCCTTCCTCGCCAGCTTGATC
CGGCCATGCAGCGCAGCGCCCGGCTGGCTTCCCTCGACCCCAACGACGGAATCGAGCTATGA
 Primer design