SecReT4
Protein ID: 160895903
T4SS name [ID]Trb [344]
Gene symbol-
Locus tagDaci_0454
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]486690..487277 [-]
Productputative conjugal transfer TRAF transmembrane protein
Component typeTraF
UniProt IDA9BR42
KEGG IDdac:Daci_0454
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.6e-53, Aligned region: 47..190
Protein Sequence: 195 a.a.     [Download]
>gi|160895903|ref|YP_001561485.1| putative conjugal transfer TRAF transmembrane protein [Delftia acidovorans SPH-1]
MTAVSTVGTAPRPRSRLRARIVLACLSACGLAALAWASFVHPLPRIIYNPSDSVAVGWYRVEPLHQRTDS
LHQPLSVGSIVLTTLPADTAALAAQRRYLPARVPLLKRVGAVAPQTVCVFDALVWIDGVPVAAVLPADRL
GRPLPSWRQCRQLRPGELFLLSVTNPASFDSRYFGPVSASAVIGVAHPIWLESRP
 
Nucleotide Sequence: 588 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c487277-486690 Delftia acidovorans SPH-1 chromosome, complete genome
ATGACCGCCGTTTCGACTGTCGGCACCGCGCCGCGTCCTCGCTCACGCCTGCGCGCTCGCATCGTGCTCG
CGTGCCTGTCTGCCTGCGGCCTCGCTGCGCTGGCCTGGGCGTCCTTCGTGCATCCGCTGCCGCGCATCAT
CTACAACCCGTCCGACAGCGTGGCGGTCGGCTGGTATCGCGTGGAACCGCTCCACCAGCGTACCGACTCG
CTGCACCAGCCTTTGTCCGTTGGCAGCATCGTCTTGACCACGTTGCCGGCAGACACCGCCGCGCTGGCCG
CGCAGCGCCGCTACCTGCCGGCGCGCGTGCCGCTGCTCAAGCGCGTGGGCGCCGTCGCGCCGCAAACGGT
GTGCGTGTTTGATGCGCTGGTCTGGATCGACGGCGTGCCGGTGGCCGCCGTGCTGCCCGCCGACCGGCTG
GGCCGTCCGCTGCCTTCCTGGCGGCAGTGCCGCCAGCTTCGGCCTGGCGAACTGTTCCTCTTGAGCGTGA
CCAACCCGGCGTCGTTCGACAGCCGGTATTTCGGGCCGGTCAGCGCATCCGCCGTGATCGGCGTCGCGCA
TCCGATCTGGCTGGAATCCCGCCCATGA
 Primer design