SecReT4
Protein ID: 160898131
T4SS name [ID]Trb [345]
Gene symbol-
Locus tagDaci_2690
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]2959059..2960327 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA9BTR4
KEGG IDdac:Daci_2690
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.1e-57, Aligned region: 226..408
Protein Sequence: 422 a.a.     [Download]
>gi|160898131|ref|YP_001563713.1| conjugation TrbI family protein [Delftia acidovorans SPH-1]
MSQDDSPDLAAQAGKVAPEAVALRAQPRPVTRLNRRTLAILVGVLSVAVLGATIWSLQPHRRGTGEQTEL
YNVDRVSKSEGLDGLPADYSKLPPKVPELGPPLPGDLGPAIVKSQQPVTPAYAQPGHDPADAWRKEADAA
ANSSVFFRSGNQGKATAPVTAQAAAAAPGSALAGFDPLAAGPASTAAQPSDPTAVQNRQDQKEAFLKGGS
TETRNSGNLQMPASPYQVMAGTVIAGALVTGIKSDLPGDVIATVTEPVYDTATGKFLLIPQGSRILGKYN
SQVSYGQSRVQVVWNRVILPDTSSLKLDNLAGTDPAGYSGLEDGVDWHWDRVFAGAALTTLLGVGAELAA
PENRQDGNRIVIAGRDSAQDSINQVGQEMTRRNMNIQPTLTERPGLPVRIIVNRDFVLRPYQPMFFNRGI
AK
 
Nucleotide Sequence: 1269 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c2960327-2959059 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAGCCAGGACGATTCCCCTGATCTTGCGGCGCAGGCGGGCAAGGTCGCGCCCGAGGCGGTGGCGCTGC
GCGCCCAGCCGCGCCCGGTCACGCGCCTGAACCGGCGCACGCTGGCCATCCTCGTCGGCGTCCTGTCGGT
CGCCGTGCTCGGGGCCACGATCTGGTCATTGCAGCCGCACCGGCGCGGCACGGGCGAGCAGACCGAGCTT
TACAACGTCGATCGCGTCTCGAAGTCCGAGGGGCTGGATGGTCTGCCGGCCGACTACTCGAAGCTGCCGC
CGAAGGTGCCCGAGCTGGGGCCGCCGCTGCCGGGTGATCTCGGCCCAGCCATCGTGAAGTCGCAGCAGCC
GGTGACGCCGGCCTACGCACAGCCGGGACATGATCCGGCGGATGCATGGCGCAAGGAGGCCGATGCGGCG
GCGAACTCGTCGGTGTTTTTCCGCTCGGGCAACCAAGGCAAGGCCACCGCGCCGGTCACGGCGCAAGCCG
CTGCGGCTGCGCCCGGCAGCGCCTTGGCGGGCTTCGACCCGCTGGCCGCTGGCCCGGCCTCGACGGCGGC
CCAGCCATCCGACCCGACAGCCGTGCAGAACCGGCAAGACCAGAAAGAGGCTTTCCTGAAAGGCGGTTCT
ACGGAAACCCGCAATTCCGGCAATCTCCAGATGCCGGCCTCGCCGTATCAGGTCATGGCGGGAACGGTGA
TCGCGGGCGCGCTGGTGACGGGCATCAAGTCCGATCTGCCGGGCGACGTGATAGCCACGGTGACGGAGCC
GGTCTATGACACGGCCACTGGCAAGTTCCTGCTGATCCCACAGGGATCGCGCATCCTGGGCAAGTACAAC
AGCCAGGTGAGCTACGGGCAGAGCCGCGTACAGGTGGTGTGGAACCGCGTCATCCTGCCGGACACGTCCT
CGCTGAAGCTAGACAACCTGGCGGGCACTGACCCTGCCGGCTATTCCGGCCTGGAGGATGGCGTCGATTG
GCATTGGGATCGCGTCTTCGCGGGTGCGGCGCTGACGACCCTGCTGGGCGTGGGTGCCGAGTTGGCCGCA
CCGGAAAACCGGCAGGATGGCAACCGCATCGTGATCGCTGGGCGCGATAGCGCGCAGGACAGCATCAACC
AGGTCGGCCAAGAGATGACCCGGCGCAACATGAACATCCAGCCGACGCTGACCGAGCGGCCGGGCCTGCC
GGTGCGGATCATCGTCAACCGCGATTTTGTGCTGCGGCCGTACCAGCCTATGTTCTTCAACCGTGGAATT
GCGAAATGA
 Primer design