SecReT4
Protein ID: 160898132
T4SS name [ID]Trb [345]
Gene symbol-
Locus tagDaci_2691
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]2960330..2961331 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA9BTR5
KEGG IDdac:Daci_2691
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.6e-66, Aligned region: 107..326
Protein Sequence: 333 a.a.     [Download]
>gi|160898132|ref|YP_001563714.1| P-type conjugative transfer protein TrbG [Delftia acidovorans SPH-1]
MNDLFRKSALPVMLLASTVLFSGCATQGKPPPTISLDEPVQAQPLPEPPKPVEVVTVPQPLALPSQLKPL
PETEEAKPAPEPADEKVRVSRANAEARVAPTREGYVNAIQVWPFTDGALYQLYAAVGRVTVVSLQPGEEL
VTVAAGDTVRWIVGDTSSGSGEALRVNVMVKPIRSGLKTNLVITTSRRTYLLELTSTEKTWMASVSWEYP
KDKMLALQRQAQAASAAAPVDSGLSLEKIRFRYAISGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPL
FVIGAQGDGQLVNYRFRAPYYIVDRLFGAAELRLGGDKGDVVRIERTDGTRRN
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c2961331-2960330 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAATGATCTTTTCCGTAAATCCGCCTTGCCGGTGATGCTTCTGGCTTCGACCGTGCTGTTCTCTGGCT
GCGCTACTCAGGGCAAGCCGCCACCGACCATTTCGCTCGATGAGCCGGTGCAGGCCCAGCCGCTGCCGGA
GCCACCAAAACCGGTGGAGGTGGTCACGGTGCCGCAGCCGCTCGCGCTGCCGTCGCAGTTGAAACCACTG
CCAGAGACCGAGGAGGCCAAGCCCGCGCCGGAACCCGCGGATGAGAAAGTGCGCGTCTCGCGCGCCAATG
CCGAGGCCCGTGTCGCGCCCACGCGCGAAGGCTACGTCAACGCGATCCAGGTCTGGCCCTTTACCGATGG
CGCGCTTTACCAGCTCTACGCGGCCGTGGGCCGCGTGACGGTGGTTTCGCTGCAGCCCGGCGAGGAACTG
GTGACGGTCGCGGCCGGCGACACGGTGCGCTGGATCGTCGGGGACACGTCGAGCGGCAGCGGTGAGGCTC
TGCGCGTCAACGTGATGGTCAAGCCGATCCGCTCGGGCTTGAAGACCAATCTGGTCATCACCACCAGCCG
CCGGACGTATCTGCTGGAGCTGACTTCGACCGAAAAGACGTGGATGGCGTCGGTGTCCTGGGAGTACCCG
AAGGACAAGATGCTGGCCTTGCAGCGCCAGGCGCAGGCGGCCAGCGCCGCCGCCCCGGTCGATAGCGGCC
TGTCGCTGGAGAAGATCCGTTTCCGCTATGCCATCAGCGGCAGCAATCCGCCGTGGAAGCCGCTGCGTGC
TTTCGATGACGGCGAGAAGGTCTACATCCAGTTCCCGCCCGGCATCGCCCAGGGCGAGCTGCCGCCGCTG
TTCGTGATCGGCGCGCAAGGCGACGGGCAACTGGTGAACTACCGATTCCGTGCGCCGTACTACATCGTTG
ATCGCCTGTTCGGCGCGGCCGAACTGCGCCTGGGCGGGGACAAAGGCGACGTGGTGCGGATTGAGCGCAC
GGACGGCACACGGAGGAACTGA
 Primer design