SecReT4
Protein ID: 160898133
T4SS name [ID]Trb [345]
Gene symbol-
Locus tagDaci_2692
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]2961328..2962032 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA9BTR6
KEGG IDdac:Daci_2692
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.9e-61, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|160898133|ref|YP_001563715.1| conjugal transfer protein TrbF [Delftia acidovorans SPH-1]
MRFKRPQVRYADTPQPATPYQSAAQVWDERIGSARVQARNWRFMAFGCLTLAVLMAGGLVWRSAQSIVTP
YVIEVDNAGQVRAVGEAATPYKPSDAQIAYHLGRFIGLVRSLSIDPIVVRQNWLDAYDYTTDKGAVVLNE
YARTNDPFARIGKESVTVQITSVTRASDTSFNVRWTETRFVNGALDRTERWNAVISTVLQTPRTEQRLRK
NPLGIYVNGLSWSRELEANEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c2962032-2961328 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCGATTCAAACGACCGCAGGTGCGCTACGCCGATACGCCACAGCCTGCTACTCCGTATCAATCCGCCG
CCCAGGTTTGGGACGAGCGCATCGGCTCGGCCCGCGTGCAGGCCAGAAACTGGCGTTTCATGGCCTTTGG
CTGCCTCACGCTGGCCGTGCTGATGGCGGGCGGCCTAGTCTGGCGCTCGGCGCAGTCCATCGTCACGCCC
TACGTCATTGAGGTGGACAACGCGGGCCAGGTGCGCGCTGTCGGCGAGGCCGCCACGCCCTACAAGCCCA
GCGATGCGCAGATCGCCTACCACCTGGGCCGCTTCATCGGCCTGGTGCGCTCGCTGTCCATCGACCCCAT
CGTGGTGCGGCAGAACTGGCTCGATGCCTACGACTACACGACCGACAAAGGCGCGGTCGTGCTCAACGAG
TACGCCCGCACGAATGACCCGTTCGCGCGCATCGGCAAGGAGTCGGTGACGGTGCAGATCACCAGCGTGA
CCCGCGCCAGCGACACGTCTTTCAACGTGCGCTGGACGGAAACGCGCTTCGTCAATGGCGCGCTGGATCG
CACCGAACGCTGGAACGCGGTGATTTCCACGGTGCTGCAAACCCCGCGCACCGAGCAGCGTCTGCGCAAG
AACCCCCTGGGCATCTACGTCAACGGGCTGTCGTGGAGCCGCGAACTGGAAGCTAACGAAGGAGCAAAAC
CATGA
 Primer design