SecReT4
Protein ID: 160898134
T4SS name [ID]Trb [345]
Gene symbol-
Locus tagDaci_2693
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]2962051..2963403 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA9BTR7
KEGG IDdac:Daci_2693
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-49, Aligned region: 37..264
Protein Sequence: 450 a.a.     [Download]
>gi|160898134|ref|YP_001563716.1| conjugal transfer protein TrbL [Delftia acidovorans SPH-1]
MNDVTVIDRFLDTFSRYIDSGFGLLHGEVAFLTATLIVIDMTLAGLFWAMSHATGQGEDVIAKLIRKVLY
VGAFAYIIGNFNWLAGIVFRSFAGLGLTASGSTLSMENFLQPGRLAKVGIDAGAPILKQIGDMAGFPEVF
VNITPIVVMFLAWLIVLLCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQVQPAEPSIDHSVVVMLASLTLLALGIFGPGIATGLVSGGPQLGAGAMAGAA
LGAAGAAVAVGAAATGVGGAVAAGARMAPAAAKLAGSGARAATGAASSARSAFQAGSASAGGGLKGAAAG
VGNVAKTGAQATGQKVAEGARSMKERVAAAFRPDDAGSASGGGAAQAANEPTPSTAQPAWAKRLHRRQQL
THAATTAAHTLRGGDCGSSSQGPSLRDSDS
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c2963403-2962051 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAACGACGTGACGGTCATCGACCGCTTCCTCGACACCTTCTCGCGCTACATCGACTCGGGCTTTGGCC
TGTTGCACGGCGAAGTGGCGTTTCTGACCGCCACGCTGATCGTCATCGACATGACGCTCGCCGGGCTGTT
CTGGGCGATGAGCCATGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGATCCGCAAGGTGCTGTAC
GTCGGCGCCTTCGCCTACATCATCGGCAACTTCAACTGGTTGGCTGGCATCGTGTTCCGCTCCTTCGCCG
GGCTGGGCCTGACGGCCAGCGGCTCGACCCTGAGCATGGAGAACTTCCTGCAACCGGGCCGGCTGGCGAA
GGTCGGCATCGACGCCGGTGCGCCGATCCTGAAACAGATCGGCGACATGGCGGGCTTCCCCGAAGTCTTC
GTGAACATCACGCCCATCGTCGTGATGTTCCTCGCTTGGCTGATCGTCCTGCTGTGCTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTTGCCGGCTTCGTGCTGGTGCCGTT
CGCGCTCTGGAACAAGACCGCATTTCTCGCCGAGAAGGTGCTGGGCAACGTGGTGTCGTCCGGCATCAAG
GTGCTGGTGCTGGCGGTGATCGTGGGCATCGGCTCGGGCCTGTTCGCCGAGTTTCAGGTACAGCCCGCCG
AACCATCCATCGACCACTCCGTGGTCGTGATGCTGGCCTCGCTGACGCTGCTGGCCTTGGGCATCTTCGG
GCCGGGCATTGCAACCGGGCTGGTGTCCGGCGGCCCGCAGCTCGGCGCAGGTGCGATGGCCGGTGCGGCG
CTGGGCGCGGCCGGCGCTGCTGTTGCCGTGGGCGCTGCGGCTACGGGCGTCGGCGGCGCAGTCGCCGCCG
GGGCGCGCATGGCGCCCGCAGCCGCCAAGCTGGCCGGTAGCGGAGCGCGTGCCGCCACTGGGGCCGCCAG
CAGCGCGCGGTCGGCGTTTCAGGCGGGTTCTGCATCCGCCGGCGGCGGCCTCAAGGGCGCTGCCGCTGGT
GTCGGCAATGTCGCCAAGACCGGCGCGCAGGCGACCGGGCAGAAGGTGGCTGAGGGCGCGCGCTCGATGA
AGGAGCGTGTCGCCGCCGCCTTCCGGCCCGATGACGCCGGATCGGCGTCAGGGGGCGGTGCCGCACAGGC
TGCAAACGAGCCAACCCCATCCACCGCGCAACCCGCCTGGGCCAAGCGCCTGCATCGCAGGCAGCAGCTC
ACCCATGCCGCGACGACCGCCGCCCACACGCTGCGCGGCGGCGATTGCGGCAGCTCCAGCCAAGGCCCGA
GCCTGCGCGATTCCGATTCCTGA
 Primer design