SecReT4
Protein ID: 160898136
T4SS name [ID]Trb [345]
Gene symbol-
Locus tagDaci_2695
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]2963738..2964493 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA9BTR9
KEGG IDdac:Daci_2695
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 251 a.a.     [Download]
>gi|160898136|ref|YP_001563718.1| conjugal transfer protein TrbJ [Delftia acidovorans SPH-1]
MKTHASKLAALTAACVLAFGIAQPAHALFGVGDIVLDPTNLVQNTLTAVRTLEQINNQIRQLQNEAQMLI
NQARNLASLPSSVVGQLRANLATTQRLIAQAKGLAYDVTSIDREFARLYPEKYAATVSGNQIYLDAQERW
KNTLNGLQTTMQMQAQASQNLSDDESVLADLVGKSQSAEGALQAMQAMNQLLALQAKQSIQTQRLQITQD
RAASLELARQAAATERGREVTRRFLGEGTPYTPQPVNFYNR
 
Nucleotide Sequence: 756 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c2964493-2963738 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAAAACCCATGCCTCCAAACTCGCCGCGCTGACCGCTGCTTGTGTGCTCGCCTTCGGCATCGCGCAAC
CCGCGCACGCCTTGTTCGGCGTCGGCGACATCGTGCTCGACCCGACCAATCTTGTGCAGAACACGCTCAC
GGCGGTTCGCACGCTGGAGCAGATCAACAACCAGATCCGCCAGCTCCAGAACGAAGCGCAGATGCTCATC
AACCAGGCGCGCAATCTGGCCAGCCTGCCGTCCAGCGTGGTCGGCCAATTGCGCGCCAATCTGGCGACCA
CCCAGCGGCTGATCGCGCAGGCCAAGGGCCTGGCCTATGACGTGACGAGCATCGACCGGGAGTTCGCGCG
CCTGTATCCCGAGAAGTACGCCGCCACTGTGAGCGGCAATCAGATATACCTCGATGCGCAGGAGCGTTGG
AAGAACACGCTCAACGGCCTGCAAACCACCATGCAGATGCAGGCACAGGCGTCGCAGAACCTGAGCGACG
ACGAAAGCGTGCTGGCCGACCTCGTGGGCAAGAGCCAGTCGGCCGAGGGTGCGTTGCAAGCGATGCAGGC
CATGAACCAGTTGCTGGCCTTGCAGGCCAAGCAGTCGATCCAGACGCAGCGGCTTCAGATCACGCAAGAC
CGCGCGGCCTCGCTGGAGCTAGCGCGGCAAGCGGCGGCCACGGAGCGCGGGCGCGAGGTGACGCGCCGCT
TCCTGGGCGAAGGCACGCCGTACACGCCGCAGCCCGTCAATTTCTACAACCGCTGA
 Primer design