SecReT4
Protein ID: 160898137
T4SS name [ID]Trb [345]
Gene symbol-
Locus tagDaci_2696
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]2964490..2966961 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA9BTS0
KEGG IDdac:Daci_2696
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.9e-39, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 1.6e-16, Aligned region: 182..388
DUF853 [PF05872], Evalue: 9.2e-05, Aligned region: 614..684
Protein Sequence: 823 a.a.     [Download]
>gi|160898137|ref|YP_001563719.1| conjugal transfer ATPase TrbE [Delftia acidovorans SPH-1]
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRLG
SGWALFIEAERRSAADYPHSDFPEPLSWLVDEERRAAFEDSGNHFESGYHLTLAYLPSEESRARAAGLLY
ENRPTEGVDWRERLHAFVAETDRIFDLLDGVMPEIAWLDDSQTLTYLHSTVSTRRYRVGVPEVPFHIDAL
LTDSALVGGLAPMLGDQHLRVVSVRGFPTSTWPGILDDLNRLGFAYRWSTRFLCLDKAEAEKELARLRRQ
WFAKRKNVIALLRETIFQQESPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDADAAVADEKL
RMVERVIQGRGFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPVSAVWAGQERNAHLDGPP
LIVTRTDGATPFRLVTHIGDVGNTLVVGPIGMGKSVLLATMAMQFRRYRGSRIFAFDMGRSIRAAILGMG
GEHYDLGADDEIAFQPLARIDREGYRTWASEWVEGRLLHEGAAVGPDEKAAIWSALGSLASAPVEQRTLT
GLTALLQSNTLRQALAPYVLGGAHGRLLDADHDRLGTSDVQAFEMEELMHSKAAVLAVLRYLFARFEERL
DGAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADVKDSAIAPAIIESCASRIFLPN
PQATEPQIRTIYEGFGLNSRQIEIVATAQPKRDYYYQSRLGNRVFDLDLGPATLAFAGASTPQDQRAIDE
VLGRVPQDAGVPGFAGAWLRHRGLDWAADLLPSFPGLTPDSLRTADHPQENLP
 
Nucleotide Sequence: 2472 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c2966961-2964490 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCTGAACCTCGCCGAATACCGCCAGCGACCGGCCTTGCTCGCCGACTGGCTGCCCTGGGCCGGACTGG
TGGCACCGGGCGTCGTCTTGAACAAGGACGGCAGTTTCCAGCGCACGGCGCGCTTTCGTGGCCCCGACCT
CGACAGCGCGACGCAAGGCGAGCTGATCGCCACATCGGCGCGCTTGAACAACGCGCTGCGCCGCCTGGGT
TCGGGCTGGGCGCTGTTCATCGAAGCCGAGCGCCGGTCTGCCGCCGACTACCCGCACTCCGATTTCCCCG
AACCGCTGTCCTGGCTGGTCGATGAAGAACGCCGCGCCGCCTTCGAGGATTCGGGCAACCACTTCGAGAG
CGGCTATCACCTGACGCTGGCCTACCTGCCGTCCGAGGAATCCCGTGCTCGGGCCGCGGGCCTGCTGTAC
GAAAACCGGCCCACCGAAGGCGTGGATTGGCGCGAGCGGCTGCACGCCTTCGTCGCTGAAACGGATCGCA
TCTTCGACCTGCTCGATGGCGTGATGCCGGAGATCGCCTGGCTTGATGACAGCCAGACGTTGACCTACCT
GCATTCGACCGTCTCGACGCGCCGCTACCGCGTCGGCGTTCCCGAAGTGCCGTTCCACATCGACGCGCTG
CTGACCGATTCCGCGCTGGTCGGTGGCCTGGCGCCGATGCTGGGCGACCAGCACCTGCGCGTGGTGTCGG
TGCGCGGTTTCCCGACCTCGACCTGGCCGGGGATTCTGGACGACCTCAACCGCCTGGGCTTCGCGTATCG
CTGGAGTACGCGCTTTCTGTGCCTCGACAAAGCCGAGGCGGAAAAAGAACTCGCCCGACTGCGCCGCCAG
TGGTTTGCGAAAAGGAAGAACGTCATCGCGTTGCTGCGCGAGACGATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGACGCCAACAACAAGGCCGCCGACGCCGATGCTGCCTTGCAGGAGCTGGGCAGCGATCAGGT
CGCCTTCGGCTACCTGACGGCGACCGTCACCGTCATGGACGCGGACGCCGCCGTTGCCGACGAGAAGCTG
CGCATGGTGGAGCGCGTCATCCAGGGGCGCGGCTTCGTCACCATCCCCGAAACGCTCAACGCCGTGGATG
CGTGGCTGTCGTCCATTCCGGGCAACGCATACGCCAATGTCCGCCAGCCCATCGTCTCGACGCTGAACCT
GGCGCACATGATGCCGGTGTCGGCGGTATGGGCCGGCCAGGAACGCAATGCGCATCTCGATGGGCCGCCG
CTGATCGTCACGCGCACAGACGGCGCCACGCCGTTCCGGCTGGTGACGCACATCGGCGACGTGGGCAACA
CGCTGGTGGTTGGCCCCATCGGCATGGGCAAGTCGGTGCTGCTGGCGACGATGGCGATGCAGTTCCGCCG
CTATCGCGGCTCGCGCATCTTCGCCTTCGACATGGGGCGCTCGATCCGCGCGGCCATCCTGGGCATGGGC
GGCGAGCACTACGACCTGGGCGCGGACGACGAGATCGCCTTCCAGCCGCTGGCGCGCATCGACCGAGAGG
GCTACCGCACCTGGGCCAGCGAATGGGTGGAAGGCCGCCTGCTGCACGAAGGCGCGGCCGTCGGCCCGGA
CGAGAAGGCGGCCATCTGGTCTGCGCTGGGGAGCCTGGCCAGCGCGCCGGTGGAGCAGCGCACGCTCACG
GGCCTGACGGCCTTGCTGCAATCGAACACCTTGCGCCAGGCACTCGCGCCCTACGTCCTGGGCGGCGCGC
ACGGCAGGCTGCTGGATGCCGACCACGACCGCCTCGGCACATCCGACGTGCAGGCGTTCGAGATGGAGGA
GCTGATGCACAGCAAGGCTGCTGTGCTCGCGGTGCTGCGCTACCTGTTCGCGCGCTTCGAGGAGCGGCTG
GATGGTGCGCCCACGCTGCTGATCCTCGATGAAGCCTGGCTGTTCCTCGATGACCCGGTGTTTGCGGCGC
GCATCCGCCAGTGGCTCAAGACGCTGCGCAAGAAGAACGTCAGTGTCATCTTCGCCACGCAGTCGCTCGC
GGACGTGAAGGATTCGGCCATCGCGCCGGCCATCATCGAAAGCTGCGCGAGCCGGATTTTCTTGCCGAAC
CCGCAAGCGACCGAACCGCAGATTCGCACGATCTACGAGGGCTTCGGCCTCAACAGCCGGCAGATCGAGA
TCGTCGCCACTGCGCAACCCAAGCGCGACTACTACTACCAATCCCGCCTCGGCAACCGCGTGTTCGACCT
CGACCTGGGGCCGGCGACGCTGGCCTTCGCGGGCGCTTCCACGCCACAAGACCAGCGCGCCATTGATGAA
GTTCTTGGCCGCGTGCCGCAGGACGCCGGCGTGCCCGGCTTCGCGGGCGCCTGGCTGCGCCATCGCGGCC
TCGATTGGGCGGCAGACCTGCTGCCCTCGTTCCCCGGCCTCACGCCGGATTCCCTCCGTACCGCTGACCA
CCCCCAGGAGAACCTGCCATGA
 Primer design