SecReT4
Protein ID: 160898138
T4SS name [ID]Trb [345]
Gene symbol-
Locus tagDaci_2697
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]2966976..2967248 [-]
Productputative conjugal transfer TrbD transmembrane protein
Component typeTrbD
UniProt IDA9BTS1
KEGG IDdac:Daci_2697
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.5e-10, Aligned region: 6..84
Protein Sequence: 90 a.a.     [Download]
>gi|160898138|ref|YP_001563720.1| putative conjugal transfer TrbD transmembrane protein [Delftia acidovorans SPH-1]
MSAPDTFAAGFEVPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGVVLWIVGHSLAMRGARV
DPQFMAVFARHIKHRPLLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c2967248-2966976 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAGTGCCCCGGACACCTTCGCGGCCGGGTTCGAGGTGCCGCTGCATCGCTCGCTCACCGAGCCGATCC
TGCTGGGCGGCGCACCGCGCACCGTGGCGATCGCCAACGGCACCTTGGCCGCCGCTGTCGGGCTGGGCCT
GCAACTGTGGATTCCCGGTGTCGTGCTCTGGATCGTCGGCCATTCGCTGGCGATGCGGGGCGCGCGCGTC
GATCCGCAGTTCATGGCCGTGTTCGCGCGGCACATCAAGCACCGCCCGCTGCTGGACGTGTAG
 Primer design