SecReT4
Protein ID: 160898139
T4SS name [ID]Trb [345]
Gene symbol-
Locus tagDaci_2698
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]2967245..2967622 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA9BTS2
KEGG IDdac:Daci_2698
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.1e-24, Aligned region: 24..115
Protein Sequence: 125 a.a.     [Download]
>gi|160898139|ref|YP_001563721.1| conjugal transfer protein TrbC [Delftia acidovorans SPH-1]
MTHVDAFRISANPLPRPARLDGLARPAMQGLMLAAFMLLLAGTAQAAGSSMPWEGPLQSILESIQGPVAR
IVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 378 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c2967622-2967245 Delftia acidovorans SPH-1 chromosome, complete genome
ATGACGCACGTTGATGCTTTCCGTATTTCCGCAAATCCGCTTCCTCGGCCCGCACGGCTGGATGGCCTGG
CTCGCCCGGCCATGCAAGGCTTGATGCTCGCTGCCTTCATGCTGCTGCTTGCGGGCACTGCGCAGGCCGC
CGGCTCCTCGATGCCCTGGGAAGGCCCGCTGCAATCCATCCTCGAATCCATCCAGGGGCCGGTGGCGCGC
ATCGTCGCGGTCATCATCATCATCGCCACGGGCCTCGCGCTCGCGTTCGGTGACACGTCGGGCGGCTTTC
GCAAGCTGATCCAGATCGTGTTCGGCTTGAGCATCGCCTTCGCCGCGTCCTCGTTCTTCCTGTCGTTCTT
CAGCTTCTCGGGCGGGGCCGTCGTATGA
 Primer design