SecReT4
Protein ID: 160898140
T4SS name [ID]Trb [345]
Gene symbol-
Locus tagDaci_2699
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]2967619..2968653 [-]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDA9BTS3
KEGG IDdac:Daci_2699
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.6e-81, Aligned region: 26..292
FtsK_SpoIIIE [PF01580], Evalue: 1.5e-06, Aligned region: 144..208
TrwB_AAD_bind [PF10412], Evalue: 1.8e-06, Aligned region: 145..185
Protein Sequence: 344 a.a.     [Download]
>gi|160898140|ref|YP_001563722.1| P-type conjugative transfer ATPase TrbB [Delftia acidovorans SPH-1]
MSAAPSSFATSLDRRIQMLRTAMGPLIAAALEDPDVVEVMLNPDRTLWVDRLSSGRAPMGVELSEADGER
IIRLVAAHVGAEVHRGQPLLSAELPETGERFEGILPPAAPGPAFALRKRAIGVIPLERYVIDGMMTSAQA
GFLVRAVRERQNVLIAGATSSGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTRAGVVSMT
ELVRSSMRLRPDRVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRALI
AEAVNVVIHIAGRGRKRRIESIARVVGFDGVGYHLADALEAPFPELLPQSDFSSLSPDHSGELP
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c2968653-2967619 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAGCGCCGCGCCTTCGTCCTTCGCCACCTCGCTCGACCGCCGCATTCAGATGCTGCGCACGGCGATGG
GGCCGCTGATCGCCGCCGCGCTCGAAGACCCGGACGTGGTGGAAGTCATGCTCAATCCTGATCGCACCCT
TTGGGTGGATCGGCTTTCATCGGGCCGCGCACCGATGGGCGTGGAGCTGTCCGAGGCGGACGGCGAGCGA
ATCATCCGCCTTGTCGCCGCCCACGTTGGCGCAGAAGTCCATCGCGGCCAGCCGCTACTGTCCGCCGAAC
TGCCCGAAACCGGCGAACGCTTCGAGGGTATCTTGCCGCCCGCCGCGCCAGGGCCGGCCTTCGCGCTGCG
GAAGCGCGCCATCGGTGTGATTCCGCTGGAGCGGTACGTCATCGACGGGATGATGACCAGCGCGCAGGCG
GGCTTTCTCGTTCGTGCCGTGCGCGAGCGGCAGAACGTCCTGATCGCCGGCGCCACCAGCAGCGGCAAGA
CCACGCTCGCCAATGCGCTGCTGGCCGAGATCGCCGCCACGGGCGACCGCGTGCTGGTGCTCGAAGACAC
GGTGGAACTGCAATGCGCGGCCCGCGACCACGTTCCGCTGCGCACCCGCGCAGGCGTGGTGTCGATGACC
GAGCTTGTGCGCTCGTCCATGCGCTTGCGGCCGGATCGCGTGGTCGTCGGCGAGGTGCGCGGCGCCGAGG
CGCTGGATCTCATCAAGGTGTGGGGCACGGGCCATCCGGGCGGCATCGCCACGATCCACGCTGGTTCCGC
GCTGGGCGCGCTGCTGCGCCTAGAGCAACTGATTCTCGAAGTGGCGGTGAACCCGCCCCGTGCGCTGATC
GCGGAAGCGGTCAACGTGGTCATCCACATCGCCGGGCGCGGGCGCAAGCGCCGCATCGAGAGCATCGCCC
GCGTCGTCGGCTTCGATGGCGTGGGCTACCACCTGGCGGATGCGCTGGAGGCTCCATTCCCGGAGCTGCT
GCCGCAGTCCGACTTTTCCTCCCTGTCCCCTGACCACTCTGGAGAACTGCCATGA
 Primer design