SecReT4
Protein ID: 160898142
T4SS name [ID]Trb [345]
Gene symbol-
Locus tagDaci_2701
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T4SS(s) in this replicon]
Location [Strand]2969111..2971120 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA9BTS5
KEGG IDdac:Daci_2701
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.7e-103, Aligned region: 111..558
TraG-D_C [PF12696], Evalue: 2.9e-31, Aligned region: 404..524
TrwB_AAD_bind [PF10412], Evalue: 3.2e-30, Aligned region: 172..539
Protein Sequence: 669 a.a.     [Download]
>gi|160898142|ref|YP_001563724.1| conjugal transfer coupling protein TraG [Delftia acidovorans SPH-1]
MQGTNVLFGQIAVVFGIVIAGVWAATQWTAAALGYQLRLGSPWFDFFGTPVYHPWRLFEWWFFFDAYAPS
VFDIGGAIAGGSGLVAVLVAIGMSIWRSRQSRLVTTYGSARWANADDIRKAGLTQPAGVFLGQHDRQYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDAKSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALERRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
CPFELTLHRMMTTPHLGYGPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIAAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVAPIKAKKLRYYADTNFKRRVLPPPV
LAAGRYADVPPSRADDWSGLAIPAVPAAPATAPTDGLEHLGSADDGGPRRQPELSEAVAYDPELAASAAD
LGLLDDDDDLPLPLPRQLDPAMQRTARLASLDPNDGIEL
 
Nucleotide Sequence: 2010 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c2971120-2969111 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCAAGGGACGAACGTGCTGTTCGGTCAGATCGCCGTGGTATTCGGCATCGTGATCGCCGGCGTGTGGG
CAGCCACACAATGGACAGCCGCCGCCCTGGGCTATCAGCTACGCCTTGGCTCGCCCTGGTTCGACTTCTT
CGGTACGCCGGTCTATCACCCGTGGCGGCTGTTCGAGTGGTGGTTCTTCTTCGATGCCTACGCGCCCAGC
GTCTTTGACATCGGCGGCGCCATTGCGGGTGGCAGCGGCCTGGTGGCCGTGCTGGTGGCCATCGGCATGT
CGATCTGGCGCTCGCGGCAATCGCGCCTGGTCACGACCTACGGCTCGGCGCGCTGGGCGAACGCGGATGA
CATTCGCAAGGCGGGACTCACGCAGCCGGCCGGCGTGTTCCTCGGCCAGCACGACCGTCAGTACCTGCGG
CATGAAGGGCCGGAACACGTCCTGACCTTCGCACCCACGCGCAGCGGTAAAGGCGTTGGCCTGGTGGTGC
CGACGCTGCTGTCCTGGCCGGCCTCGGCCGTCATCCACGACATCAAGGGCGAGAACTGGCAGATCACCGC
AGGCTGGCGCTCGCGCTTCTCGCATTGCCTGCTGTTCAACCCGACCGATGCGAAGTCAGCGGCCTACAAC
CCGCTGCTGGAGGTGCGTCGCGGCGCCCATGAGGTGCGCGACGTGCAGAACATCGCGGACATCCTGGTCG
ATCCCGAAGGCGCGCTGGAGCGGCGCAACCATTGGGAGAAGACCAGCCATGCTCTGCTGGTCGGCGCCAT
CCTGCACGTGCTCTATGCGGGCGAGGACAAGACGCTGCGCGGCGTCGCCAACTTCCTCTCCGATCCGGCT
TGCCCATTCGAGCTGACGCTGCACCGGATGATGACCACGCCGCATCTCGGCTATGGCCCGCATCCGGTCG
TCGCATCGGCGGCGCGCGAAGTGCTCAACAAGTCGGACAACGAGCGTTCCGGCGTGTTGAGCACGGCCAT
GTCGTTCCTCGGCCTGTACCGCGACCCTACGGTGGCCGAAGTCACGTCGCGTTGCGATTGGCGCATTGCC
GACCTGATCGCGGCCGAGCATCCGGTATCGCTGTACCTTGTGGTGCCGCCTTCAGATATTTCGCGGACGA
AGCCGCTGATCCGCCTGATCCTCAATCAGATCGGGCGACGGCTGACGGAATCGCTCGATGGCTCCGACGG
CATCGAGCGCCGCCACAAGCTGCTGCTGATGCTTGACGAGTTCCCGGCGCTCGGGCGGCTCGACTTCTTC
GAGACGGCACTGGCCTTCATGGCGGGCTATGGCATTCGCAGCTTTCTCATCGCGCAGTCGCTCAATCAGA
TCGACAAGGCGTATGGGCAGAACCATTCGATTCTGGACAACTGCCATGTCCGCGTGACGTTCGCCACCAA
CGACGAACGCACGGCCAAGCGGATCTCCGAAACGCTGGGCACTGCAACCGAGCTGCGCGCACAGCGCAAC
TACGCAGGCCACCGGCTCGCGCCGTGGCTGGGCCACCTGATGGTGTCGCGCCAGGAGACCGCGCGCCCAC
TGCTGACGCCGGGCGAAGTGATGCAGTTACCGCCGGATGAAGCCGTGGTGATGGTGTCCAGCGTGGCGCC
GATCAAGGCCAAAAAGCTGCGCTATTACGCGGACACCAATTTCAAGCGGCGCGTGCTGCCGCCGCCCGTG
CTTGCGGCCGGACGCTATGCCGACGTTCCGCCCTCGCGAGCCGACGACTGGAGCGGGCTGGCGATTCCCG
CCGTGCCTGCCGCACCGGCCACTGCACCTACTGATGGCCTGGAGCACTTGGGTTCGGCCGACGACGGCGG
ACCGCGCCGTCAGCCCGAACTTTCCGAAGCCGTCGCCTACGACCCCGAGCTGGCCGCGTCCGCAGCCGAC
CTCGGGTTGCTCGATGACGATGACGACCTGCCGCTTCCCCTTCCTCGCCAGCTTGACCCGGCCATGCAGC
GCACGGCCCGGCTGGCTTCCCTCGACCCCAACGACGGAATCGAGCTATGA
 Primer design